KEGG   Streptococcus mutans GS-5: SMUGS5_03870Help
Entry
SMUGS5_03870      CDS       T02185                                 

Definition
fructose-1-phosphate kinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
smut  Streptococcus mutans GS-5
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SMUGS5_03870
Enzymes [BR:smut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SMUGS5_03870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
814591..815502
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDFIVRIDSVKIGSVNRMDSDDKFVGGKGINVSRILKRLGQDNTATGFIG
GFTGRFVEEGLIAEGIKTNFVHVNQDTRINVKIKADQETEINGTGPVITKEQVLALENIL
QQLSQDDTVVFAGSAPSNLGNQIYERLIPLVRQTGAQIVCDFEGQTLLDALDYQPLLVKP
NNHELEAIFKVNLNGITDVEKYARQILAKGAQNVIISMAGDGALLVTSDATYFAKPIKGQ
VRNSVGAGDSMVAGFTGEFVKSANPLEALKWGVACGTATAFSDDLASIDFIKETYEKVEV
EKL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacggtaacccttaatccttctattgattttatcgttcgtattgatagtgta
aaaatcggcagtgtcaatcgtatggatagtgacgataaatttgttggaggtaaagggatt
aatgttagtcgtattcttaagcgtttaggacaggataatacggcgacaggttttattggc
ggttttactggtaggtttgttgaggaaggattgattgctgaaggaatcaagactaacttt
gtccatgttaatcaagataccagaattaatgtcaaaattaaggctgatcaagaaactgaa
attaatggtacaggccctgtcattacaaaagaacaagttttagctttagagaacatctta
cagcaactttcacaagacgatacagttgtttttgcaggcagtgcaccgtccaatttagga
aaccaaatttatgaacgcttgatcccgttggtgagacaaacaggagcgcaaattgtttgc
gattttgaagggcaaactttattggatgctcttgactatcaaccgcttttggttaaacca
aataatcatgaacttgaagctattttcaaggtaaacttaaacggtattactgatgttgaa
aagtatgcccgccaaattcttgctaaaggcgcacaaaacgtcattatttcaatggcagga
gatggcgctttattagtaacatcagatgcgacttattttgctaaaccgattaagggacag
gtcagaaattctgtcggtgctggtgattcaatggttgctggttttactggtgaatttgtt
aagtcagctaatcctcttgaagctctcaaatggggagtggcttgcggtacagcaaccgct
ttttcagatgatttagccagtattgattttataaaagaaacatatgaaaaagtagaggta
gaaaaattatga

DBGET integrated database retrieval system