KEGG   Streptococcus mutans GS-5: SMUGS5_03905Help
Entry
SMUGS5_03905      CDS       T02185                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
smut  Streptococcus mutans GS-5
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SMUGS5_03905
  Lipid metabolism
   00561 Glycerolipid metabolism
    SMUGS5_03905
   00600 Sphingolipid metabolism
    SMUGS5_03905
Enzymes [BR:smut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SMUGS5_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824448..826610
Genome map
AA seq 720 aa AA seqDB search
MGIVIKDNLFYIHTKDSSLIIEERDGDLLLKHLGKKIEAYHFSNTVFEKDHAFSANPVAD
NRNYSYDTQRQIFGVHGFGDFRVPSLILQHDNNDLTRFKFKKAKIIKGGIKARGLPNPHS
SESAQSLALILEDDLAKLRMTLYYTAYDDNATISTFVKFENLSDKPVILHRALSTMFDLP
ASHYDVITFQGAYAREKTLRRHQIEQGLFKIGSNRGASGHAQTPSLILTEHDSNEFYGEA
LALQLIYSGNFQAFVQKNQLNEVRLGIGINDDNFSWDLQANQSFETPVALITYTDKGLTD
LTQESHNFIKRHIIPKNFANKERPILINNWEATYFDFNRSQLLGLADEARKLGIELFVLD
DGWFGHRFDDNSSLGDWFVNEEKLGGSLDSFIKEIHDRGLQFGLWFEPEMVSVDSKLYRA
HPDWVIQADQREHTYSRNQLVLNLANPDVVAYIKTVLDKLLTENTIDYVKWDYNRNITNI
GNGRTYLETQMQSHAYILGLYDIVSYLTTKHDKVLFESCSGGGGRNDLGMMCYFPQVWSS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMNRHTPLTTRGHVAMMGNLGYELDL
AILTKNEKKAVANQIKHYKKIRSVVQFGKLYRLINPEVGINEVAVQYTYDNQVLVTYVRI
QSTIEMMETTVKLRGLDADAIYVLIETGQAFSGAELMYAGLTIDMPQGDYLSKQYYFIKK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgttattaaagataaccttttttatatacacaccaaagactcatcattgatt
attgaagaaagagatggtgatttgcttttaaaacatctaggtaaaaaaattgaagcctat
catttttccaatactgtttttgaaaaggatcatgctttttcagctaatccagtggcggac
aatagaaattatagttatgatacacaaagacaaatatttggtgttcatggttttggtgat
tttagagtgccttcactaatccttcaacatgataataatgatttaacacggtttaaattt
aagaaggctaaaattattaagggggggatcaaggcaagaggtttgcctaatccacatagc
agtgagagtgctcaaagcttggctcttatcttagaagatgatttggcaaaactgcgcatg
actctgtattatacggcttatgatgataatgccaccatttcaacctttgtcaaatttgaa
aatttatctgataagcctgttattcttcatcgtgctttatcaacaatgtttgatttacct
gccagccattatgatgtgataacttttcaaggagcttatgctcgcgagaagacgcttcgg
cgccaccagattgaacagggtctgtttaaaataggctctaatcgaggagcttcaggacat
gctcaaaccccttccttaattttaacagagcatgatagcaatgagttttatggagaggct
ttggctttacaattaatctatagcggaaattttcaagcttttgttcaaaaaaatcaatta
aacgaggttcgcttaggcatcggaataaatgatgataatttttcatgggacctgcaggct
aatcagagttttgagacacctgtagctttgataacctacactgataaaggattaacggat
ctgacacaagaaagtcataattttattaaacgtcatattattcctaagaattttgctaat
aaggaacgtcctatccttatcaataattgggaggcaacatattttgattttaatcggagt
caattgctggggctggcagatgaagccagaaaacttggcattgaactctttgtgcttgac
gatggttggtttggtcatcgttttgatgacaatagctcacttggtgattggtttgtcaat
gaagaaaaacttggtggttcccttgatagctttatcaaggaaattcatgatagaggatta
cagtttggcctttggtttgaaccagaaatggtatcagttgacagcaaactttatagagct
catcctgattgggtcattcaggcagatcagcgagagcatacttattctcgcaatcaattg
gtcttgaatctagctaatcccgatgtagttgcttatataaaaactgttcttgataagctg
ctgacagaaaatacgattgattatgttaaatgggactacaaccgcaatataaccaatatt
ggcaatggcagaacttacttggaaacgcaaatgcagtcgcatgcttatatactggggttg
tatgatattgtttcttacttaacaacaaaacacgataaggtcttgtttgaatcctgttca
ggaggtggcggtcgcaacgatttggggatgatgtgttattttcctcaagtgtggtcaagt
gataatacagatgctattgcaagactgcctatacagtatggttcctcttatctttaccca
actatttctatgggagctcatgtttcagcggttcctaaccatcaaatgaaccgtcatacc
cctcttacaacacgaggtcatgttgctatgatgggaaatttaggttatgaattggactta
gcaatcttaaccaaaaatgaaaaaaaggctgttgccaatcagattaaacattataaaaag
ataaggtctgttgtacaatttggcaagctttaccgtctaattaatcccgaagttggaatt
aatgaggtagcagtgcaatatacctatgacaatcaggtactggttacctatgtccgtatt
caatcaaccatagagatgatggaaacaactgtaaagttgagaggactagatgcagatgcc
atttatgttcttatagaaactggacaagccttttcaggtgcggagttaatgtatgcggga
ttgaccattgatatgccgcaaggtgattatttgagtaaacaatactattttattaaaaag
tag

DBGET integrated database retrieval system