KEGG   Streptococcus mutans GS-5: SMUGS5_03925Help
Entry
SMUGS5_03925      CDS       T02185                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
smut  Streptococcus mutans GS-5
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMUGS5_03925
Enzymes [BR:smut01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SMUGS5_03925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829814..831259
Genome map
AA seq 481 aa AA seqDB search
MPITNKTMLITYADSLGKNLKELNENIENYFGDAVGGVHLLPFFPSTGDRGFAPIDYHEV
DSAFGDWDDVKRLGEKYYLMFDFMINHISRQSKYYKDYQEKHEASAYKDLFLNWDKFWPK
NRPTQEDVDLIYKRKDRAPKQEIQFADGSVEYLWNTFGEEQIDLDVTKEVTMDFIRSTIE
NLAANGCDLIRLDAFAYAVKKLDTNDFFVEPEIWTLLDKVRDIAAVSGAEILPEIHEHYT
IQFKIADHDYYVYDFALPMVTLYSLYSGKVDRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEITYTSNELYKVGANVNRKYSTAEYNNLDIYQINSTYYSALGDDDQKYFLARLI
QAFAPGIPQVYYVGFLAGKNDLELLESTKEGRNINRHYYSSEEIAKEVKRPVVKALLNLF
TYRNQSAAFDLDGRIEVETPNEATIVIERQNKDGSHIATAEINLQDMTYRVTENDQTISF
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccaattacaaataaaacaatgttgattacttacgcagacagtttgggtaaaaatttg
aaagaattgaatgaaaatattgagaattattttggagatgctgttggcggtgtccatttg
ctgccattctttccttccacaggtgatcgtggctttgcaccgattgattaccatgaagtt
gactctgcttttggcgattgggatgatgtcaaacgcttgggtgaaaaatattacctcatg
tttgatttcatgattaatcatatttcgcgtcagtctaaatattataaagattaccaagaa
aagcatgaagcaagtgcttataaagatctatttttaaattgggataaattttggcctaaa
aatcgcccgacacaagaagatgtggacctgatttataagcgtaaggatcgagcacctaag
caggaaatccaatttgcagatggcagtgttgaatatctctggaacacttttggggaggaa
cagattgatcttgacgtgactaaagaagtgactatggattttattcgctctaccattgaa
aatttagcagccaacggctgtgatctcattcgtttggatgcctttgcttatgctgttaaa
aagctagatacgaatgatttctttgttgaacctgaaatctggactctgctagataaagtt
cgtgatatagctgctgtatcgggtgcggaaatcttgccggaaattcatgaacactatact
attcaatttaaaattgcagaccatgattactatgtttatgattttgctctgcctatggtg
acgctctacagcctatattcgggcaaggttgaccgtcttgccaaatggctgaaaatgagt
ccgatgaaacagttcaccacccttgatacacatgacggtattggtgtggttgatgttaag
gatatcttgactgacgaagaaattacctatacttctaatgagctttataaggtcggtgcc
aatgtcaatcgtaagtattcaactgccgaatataataacttggatatctatcaaattaat
tcaacttactattcagcacttggtgatgatgatcaaaaatactttttggcccgcttgata
caagcttttgctccaggtattccacaggtttattacgttggctttttagctggcaagaat
gatcttgaattactggaaagcactaaagaaggccgcaatatcaaccgtcattattatagt
agtgaagaaattgctaaggaagtgaagcgaccagttgtcaaggcacttttaaatctcttt
acttaccgcaatcagtcagcagcttttgatttggatggccgtattgaagtggaaacgcca
aatgaagcgaccattgtcatagaacgtcaaaataaagatggcagtcatatcgcaacagca
gagattaatctccaagatatgacatacagagtaacagaaaatgatcaaacaataagcttt
gaataa

DBGET integrated database retrieval system