KEGG   Streptococcus mutans GS-5: SMUGS5_04295Help
Entry
SMUGS5_04295      CDS       T02185                                 

Definition
2-amino-4-hydroxy-6-hydroxymethylpteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
smut  Streptococcus mutans GS-5
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMUGS5_04295
Enzymes [BR:smut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SMUGS5_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907501..907980
Genome map
AA seq 159 aa AA seqDB search
MTLVYLSLGSNIGERQTYLQRALEELAHLSHITLQAVSPIYETAAWGKTDQADFLNIVCQ
LETDLSPYDLLEACQKIEKHLNRVRHEHWGPRTIDIDILFYGNTIIKEDNLKIPHPYLQK
RAFVLVPLNDIASELVHPVLKETVAVLLEKVDKSGVKIW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtttatttaagtctaggcagtaacataggagaacggcagacttatttgcag
agagctttagaggaactggctcatctctctcatattactttacaggcagtgtcccctatc
tatgaaacagcggcctggggaaagacagatcaagctgattttttaaatattgtttgtcaa
ctcgaaactgacttatcaccatacgatttactagaggcttgtcaaaaaattgaaaaacat
ttaaatcgtgtccgtcatgaacattggggtcccagaacaattgatattgatatcttattt
tatggaaatactattattaaagaggataacctcaaaatcccccatccctatttgcagaag
cgtgcttttgttttggttcctcttaatgatattgccagtgaattagttcatccggtttta
aaggaaacggtagctgttttgctggaaaaagtggacaaatcaggagttaaaatctggtag

DBGET integrated database retrieval system