KEGG   Streptococcus mutans GS-5: SMUGS5_05295Help
Entry
SMUGS5_05295      CDS       T02185                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smut  Streptococcus mutans GS-5
Pathway
smut00010  Glycolysis / Gluconeogenesis
smut00030  Pentose phosphate pathway
smut00051  Fructose and mannose metabolism
smut00052  Galactose metabolism
smut00680  Methane metabolism
smut01100  Metabolic pathways
smut01110  Biosynthesis of secondary metabolites
smut01120  Microbial metabolism in diverse environments
smut01130  Biosynthesis of antibiotics
smut01200  Carbon metabolism
smut01230  Biosynthesis of amino acids
smut03018  RNA degradation
Module
smut_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMUGS5_05295
   00030 Pentose phosphate pathway
    SMUGS5_05295
   00051 Fructose and mannose metabolism
    SMUGS5_05295
   00052 Galactose metabolism
    SMUGS5_05295
  Energy metabolism
   00680 Methane metabolism
    SMUGS5_05295
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SMUGS5_05295
Enzymes [BR:smut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMUGS5_05295
Protein phosphatases and associated proteins [BR:smut01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMUGS5_05295
Messenger RNA biogenesis [BR:smut03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SMUGS5_05295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFM81570
Position
complement(1114690..1115703)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAISEGMEVCGINRGYAGMVEGDIFPLDAKGVSNI
LSRGGTFLQSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVNTATDALDKIRDTSFSHGRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEPYDIKEVVANVKNGYLSKSKNHHLIVLAEGVMHGEEFAAQMKEAGD
NSDLRVTNLGHILRGGAPTPRDRVIASWMGAHAVELLREGKGGLAIGIQNEELVEHPILG
SAEDGALFSLTEQGEIVVNNPHKARLDFAALNRDLSN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagacgctcctggtatgaatgctgccgtt
cgtgcagtcgttcgtaaagcaatttctgaaggaatggaagtttgcggaatcaatcgtggt
tatgctggtatggttgaaggagatatcttcccgcttgacgctaaaggtgtatcaaacatc
ctttctcgtggagggacatttctccagtccgcacgttaccctgaatttgcaaagcttgaa
gggcaattaaagggtatcgagcaactcaaaaagcatggcattgaaggagtcgttgttata
ggcggcgatggttcttatcatggtgcgatgcgcttgactgagcatggttttcctgctgtc
ggtcttccgggtacaattgataacgatatcgtaggaactgattatacaattggttttgat
actgcagtaaacactgctacggatgcacttgataaaattcgtgatacctcatttagtcac
ggcagaacttttgttgttgaggttatgggacgtaatgcaggagatattgctctttggtct
ggtattgctgccggtgctgaccaaattattattcctgaagagccctatgatattaaagag
gttgtcgccaatgtgaaaaatggctatcttagtaagtctaaaaaccaccatctcattgtt
cttgccgaaggcgttatgcatggtgaagagtttgctgctcagatgaaggaagcaggagat
aatagtgatcttcgtgttaccaaccttgggcatatcctgcgcggtggtgcaccaactcct
cgtgatcgtgtgattgcttcatggatgggagcccatgccgttgaattgctcagggaagga
aaaggcggtcttgccattggtattcaaaatgaggagttggttgagcatccaattcttgga
tctgcggaagacggtgcactctttagtttaacagaacaaggcgagatcgttgtaaataat
ccgcataaagcacgtcttgattttgctgctttgaatcgtgatttgtccaactaa

DBGET integrated database retrieval system