KEGG   Streptococcus mutans GS-5: SMUGS5_05685Help
Entry
SMUGS5_05685      CDS       T02185                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
smut  Streptococcus mutans GS-5
Pathway
smut00340  Histidine metabolism
smut01100  Metabolic pathways
smut01110  Biosynthesis of secondary metabolites
smut01230  Biosynthesis of amino acids
Module
smut_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SMUGS5_05685 (hisD)
Enzymes [BR:smut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SMUGS5_05685 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh YusW PhoU
Motif
Other DBs
NCBI-ProteinID: AFM81644
Position
complement(1188560..1189843)
Genome map
AA seq 427 aa AA seqDB search
MKRLTGTNEEISNILYQEQLELSKENLDVEATVREIIEKVKEEGDEALRAYSEKFDHVVL
SELHVSDQVVNEAFDKIDKDVLTALENAKANIESYHKQQLEGGFEDQPSQGVLRGQLIRP
IERVGVYVPGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQEHFVPAILVAAKLAGVDKI
YQVGGAQGIAALAYGTQTLPKVDKITGPGNIFVATAKKLVYGVVGIDMIAGPSEIGVIAD
STANPVYVAADLLSQAEHDIRARAILVTNSAELADAVELEIEKQLQTLPRQAIARPSIEN
NGRIIIAQDVESMFELMNLVAPEHLEIAIDKAYDYLERVQNAGSIFLGHYTSEPIGDYYA
GANHVLPTTATSRFSSALGVHDFVKRIQYTQYSKAAVNAAEKDITTLAYAEGLQAHARAI
EVRNDKN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttaacaggaacaaatgaagagatttctaacattttatatcaagagcagctg
gaactcagcaaggaaaatttagatgttgaagcgactgttcgtgagattatcgaaaaagtc
aaagaagaaggtgatgaggctttacgagcttattctgaaaaatttgatcatgttgtatta
tctgaattgcacgtttcggatcaagttgtcaatgaagcttttgacaagattgataaagat
gttctcacagcacttgaaaatgcaaaagctaatattgaatcctaccataagcaacaatta
gaaggaggttttgaagatcaaccctctcaaggggtgcttcgcggacagctgattcgtccc
attgagcgcgttggtgtctatgttcccggtggaacagcagcttatccatcatctgtactc
atgaatgttattccagctaaaattgctggtgtgaaagaaatcattatgattacaccgccg
caagaacattttgtcccagctattttggttgctgccaaactggccggtgttgataaaatt
tatcaggttggcggtgcccaaggaattgcagctttggcttatggcacacaaacactgcct
aaagtggataagattacaggcccgggcaatatctttgtagcaactgctaaaaagttggtt
tatggtgtggtaggcattgatatgattgctggaccatcggaaattggtgtcatcgcagat
agtacagccaatcctgtttatgtggctgctgatttgctgtctcaagcagaacatgatata
cgtgcccgtgctattctcgtgactaactcagctgaattggctgatgcggttgaattagaa
attgaaaagcagttgcaaaccttgccacgtcaggctatcgctcgtccttcaattgaaaat
aatggtcgaattattattgcccaagatgtggagagcatgtttgaactcatgaatttagtg
gcgccagagcacttagaaattgctatagataaagcttatgattatttggaacgggtacaa
aatgctggttcgattttccttggacattacaccagtgaaccaattggtgattattatgct
ggtgccaaccatgtgctgccgacaacagctaccagtcgtttttcatcagcacttggtgtg
catgactttgtcaaacgcatccaatacacgcaatacagtaaggctgccgttaatgcagct
gaaaaagacattacaacccttgcctatgccgaaggtttgcaggcacatgccagagcaatt
gaggtgagaaatgacaaaaactaa

DBGET integrated database retrieval system