KEGG   Streptococcus mutans GS-5: SMUGS5_06340Help
Entry
SMUGS5_06340      CDS       T02185                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smut  Streptococcus mutans GS-5
Pathway
smut00010  Glycolysis / Gluconeogenesis
smut00020  Citrate cycle (TCA cycle)
smut00620  Pyruvate metabolism
smut01100  Metabolic pathways
smut01110  Biosynthesis of secondary metabolites
smut01120  Microbial metabolism in diverse environments
smut01130  Biosynthesis of antibiotics
smut01200  Carbon metabolism
Module
smut_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMUGS5_06340
   00020 Citrate cycle (TCA cycle)
    SMUGS5_06340
   00620 Pyruvate metabolism
    SMUGS5_06340
Enzymes [BR:smut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMUGS5_06340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N NQRA HlyD_D23 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AFM81767
Position
complement(1338289..1339542)
Genome map
AA seq 417 aa AA seqDB search
MATEIVMPKLGLTMTEGLINQWLVKEGDTVAAGDPVLEISSEKLTSEVEAPEAGVILKIV
KGEGETVPCKQIIAWIGQEGEAVPDAAGDAPEVDTEAESEVASAGQTVVPEESRTVSAAP
VAEKHEDGRIFITPLARKIAKEKGLDITYIKGTGGNGRITRRDVEAFNPASIPTAEPVTA
LSAPTNVNYGVGLTGMRKIIAERMMSSIHSSAQLTLHRKADVTPLMAFRQDIKTKVNAPL
ENGEIGITTLLTKAVTKALKDYPEANAWYAGGQYEEKEDIHIGMATALSDGLVVPVIRHA
DKLTLSDLGRTIKEEAEQARKGTLDPSLYSGSTFSITNLGAQGIEYFTPILNAPEVAILG
VGAIQKALTLDENGQVAEKQFLPLSLTFDHQVLDGAPAAEFLGAVISYLEDAYSLVF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaaatcgtgatgcctaaattaggtttaaccatgacagaagggctaattaac
caatggctcgttaaagaaggcgacacagttgcagctggcgatcccgtgttggaaattagt
tctgaaaagttaacaagtgaagttgaagctccagaagctggtgttattttaaaaatagtt
aagggagaaggtgagactgttccttgtaaacaaatcattgcttggattggtcaagaaggt
gaggctgttcctgacgctgcaggtgacgctccagaagtagatacagaagctgaaagtgaa
gttgcttcagcagggcaaacagtagttccagaagaaagtaggactgtttcagcagcgccc
gttgctgaaaagcatgaagacggacggatttttatcacaccgcttgctcgaaagattgcc
aaggaaaaagggctagacattacttatatcaaaggaacaggcggtaacggacgtatcaca
cgccgtgacgttgaagcctttaatcctgctagcattcctacagctgaacctgtaacagct
ttaagtgctccaacaaatgtaaactatggtgttggtttaacaggtatgcgcaaaatcatt
gctgagcgcatgatgagtagtatccattctagtgctcaattaacgcttcatcgaaaggca
gatgttacgcctttaatggctttcaggcaagatataaaaactaaggttaatgcaccgctt
gaaaacggggaaattggcattacaaccttattgaccaaagcggtaacgaaggctttgaaa
gattatcctgaagcgaatgcttggtatgcaggcggtcaatatgaagaaaaagaagatatt
catattggtatggcaactgctttgagtgatggtttggtcgttcctgttattcgtcatgcc
gataaattaacgctgtcagatttgggacgaactattaaagaagaagcagaacaagcacgt
aaaggaactctggatccatccttgtattcaggttccacattctctattaccaatctaggt
gctcaaggcattgaatactttacaccgattttgaatgcacctgaagttgctatcttaggt
gttggagctatccagaaagctttgactcttgatgagaatggtcaagtagctgaaaaacaa
tttttaccacttagtttgacctttgaccatcaagtcttagatggtgcaccagcagctgaa
tttttaggagctgttatctcctacttggaagatgcttatagtctggtattctaa

DBGET integrated database retrieval system