KEGG   Streptococcus mutans GS-5: SMUGS5_06380Help
Entry
SMUGS5_06380      CDS       T02185                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase MurC
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
smut  Streptococcus mutans GS-5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:smut00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:smut00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349352..1350695
Genome map
AA seq 447 aa AA seqDB search
MTLKSRIGILAGKTAHFFLSKIGRGSTLPGKIALKCDKDILDTLAKDYDIVVVTGTNGKT
LTTALTVGILKKAYGQVLTNPSGANMITGITSTFLTAKKSRNGKKIAVLEIDEASLPKIT
DYLKPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPKATILANGDSPLFNAKTVVNP
VRYYGFDTKKEAAHLAHYNTEGIVCPKCEYILQYKLNTYANLGDYICPNCGFHRPHLDYS
LTQLTKISNTQAEFIIDGQDYKINVGGLYNIYNALAAVAVAEFLGVTPEQIKAGFDKSRA
VFGRQETFKIGDKSCTLVLIKNPVGASQALEMIKLAPYPFTLSVLLNANYADGIDTSWIW
DANFESILDMNIPQIFTGGVRHSEIARRLRVTGYNETKIEQAEKLEDILSMIEKQEADHA
YILATYTAMLEFRELLASRHAVRKEMH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaatcgagaataggaattttagctggtaaaacagcacacttttttctcagt
aaaatagggcgcggctctaccttacctggaaaaattgctcttaagtgcgataaagatatt
ttagatacacttgctaaagattatgacattgttgttgtcacaggcactaatggaaaaacc
ttaacaacagctttaacagtaggaattttaaaaaaggcttacggtcaggtgctaactaat
cctagtggtgccaatatgattacaggaattacctcaacttttttaactgctaaaaaatct
agaaatggtaaaaagattgcggtgctggagattgatgaagccagccttcctaaaattaca
gattatctaaagcccagcctttttgttttcaccaatatttttcgtgatcaaatggatcgt
tacggtgaaatttatactacctatcaaatgattttggacggtgctgccaaagcgccaaaa
gcaactattttagctaatggagatagcccactctttaacgccaaaacagttgttaatcct
gtgcgttactatggttttgatacaaaaaaagaagctgctcacttggcacattacaatact
gaaggcatcgtctgtcctaagtgcgaatatatcctacaatacaagcttaatacttatgcc
aacttgggcgactacatctgccccaactgtggttttcaccgtcctcatctggattacagc
ttgactcagctaaccaagattagcaacactcaagctgagttcatcattgacggacaggat
tataagatcaatgtcggcggcctttataatatctataatgccttggctgcagtcgctgtt
gcagaatttctcggtgtaactcctgaacaaatcaaggctggctttgacaagagccgtgct
gtttttggacgccaagaaacctttaaaatcggcgataagtcatgtactcttgttttaata
aaaaatcctgttggtgccagtcaagcactagaaatgattaaactagcaccttatcctttc
accttatctgtccttctcaatgccaattatgctgatggcattgataccagctggatttgg
gatgcgaattttgagagcattttagatatgaacattccacaaatctttacaggtggtgtc
cgccattcagaaatagccagacgtctgcgtgttactggttacaatgaaacaaagattgag
caggctgaaaaacttgaagacattctaagtatgattgaaaaacaagaggctgatcatgcc
tacattctagctacttacacagccatgttggaattccgcgaattactagccagccgtcac
gcagtaagaaaggagatgcattaa

DBGET integrated database retrieval system