KEGG   Streptococcus mutans GS-5: SMUGS5_06515Help
Entry
SMUGS5_06515      CDS       T02185                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smut  Streptococcus mutans GS-5
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SMUGS5_06515
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMUGS5_06515
Enzymes [BR:smut01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SMUGS5_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1377588..1378184)
Genome map
AA seq 198 aa AA seqDB search
MTEEQFFGKELAACKIDAIPGMIEFDIPVHGDNRGWFKENFQKEKMVPLGFPESFFAEGK
LQNNVSFSRKNVLRGLHAEPWDKYISVADEGKVLGSWVDLREGDSFGHVYQAVIDASKGI
FVPRGVANGFQVLSDKVSYSYLVNDYWALELKPKYAFVNYADPTLGIEWENLEEAQVSEA
DKNHPLLKDVKPLKAEDL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaacaattttttggcaaggaattagcagcatgcaagattgatgctattcct
ggaatgattgaatttgatattccagtccacggcgataaccgcggttggtttaaagaaaat
tttcaaaaggaaaaaatggtgccgctaggttttccagaaagcttctttgcagaaggcaaa
ttgcaaaataatgttagcttttcccgtaaaaatgttttacgcggtctgcatgcagaacca
tgggataaatacatttcagtagcggacgagggaaaggttctcggttcttgggttgatctg
cgtgaaggcgatagttttggtcatgtttaccaagcagttattgatgcttccaagggtatc
tttgttccccgcggtgtggctaatggtttccaagtcttatctgacaaggtttcttacagt
tatctcgttaatgactactgggcgcttgaactcaaaccaaaatacgctttcgtcaactat
gctgatccaacattaggaattgaatgggaaaatttggaagaagcgcaagtctcagaagcg
gataaaaaccacccattgctcaaagatgttaaaccattaaaagcagaagatttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system