KEGG   Streptococcus mutans GS-5: SMUGS5_07045Help
Entry
SMUGS5_07045      CDS       T02185                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smut  Streptococcus mutans GS-5
Pathway
smut00500  Starch and sucrose metabolism
smut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMUGS5_07045
Enzymes [BR:smut01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SMUGS5_07045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77 PSD4
Motif
Other DBs
NCBI-ProteinID: AFM81904
Position
complement(1492687..1494216)
Genome map
AA seq 509 aa AA seqDB search
MEKRASGILMHISSLPGKFGIGTFGQEAYDFVDFLKKTGQTYWQLLPLTTTSYGDSPYQS
FSAVAGNVNFIDFKKLQEAGLLDEDDYNSVSFGEDEEIVDYALLFKVRRPILEKAVINFL
ADKTNLKKLSLFEEKNETWLDDYAEFMAIKEHFGNKSLQEWGDKKAIRRDEERLVRYRHL
LADEISYHKVTQYFFFEQWLALKAYANKNNIKIIGDMPIYVAKDSVEVWTMPELFKMDDD
LQPLSVAGCPPDEFSDEGQLWGNPIYDWKKHRETGFAWWIYRIQESFKIYDILRIDHFKG
FSDYWEIKGNSKTAKNGSWHPGPGIALFRAVQNVLGDLPIIAEDLGYVDDRARQLLKETG
FPGMKILEFGFYDLSGRSVDIPHHYVQNSVAYIGTHDNDVVNGWYDRLTVEQEEFVDAYT
NRKPIEPVNQAMLRLLFSTVSNTAILTMQDLLNKPASSRMNTPSTIGGNWQWRMRAKDLT
QDKIDFLSKLTKLYQRGNEENDTKNKTIQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgcgcaagtggtatcctgatgcatatcagttctctaccgggaaaatttgga
attggtacttttgggcaggaagcttatgattttgttgatttcctaaaaaaaacaggtcaa
acatattggcagctcttacccttaacgacaacgagttatggtgattctccttaccaatct
ttttctgccgttgctggtaatgtgaattttattgattttaagaaattacaagaagctggc
ttattggacgaggatgactataattctgtttcttttggagaagacgaagaaattgttgat
tatgctctattatttaaagtacgtcggccaattttggaaaaggctgttatcaattttctg
gcagacaagactaatctgaaaaaattatctctgtttgaagaaaaaaatgaaacttggctt
gatgactatgctgaatttatggccatcaaggagcattttggcaataagtctttgcaagag
tggggcgataaaaaggctattcgccgtgatgaggagcgtttggtacgttatcgtcatttg
ttggccgatgaaattagctaccataaggttacacagtacttcttcttcgaacaatggctg
gcgctgaaagcttatgctaataaaaataatatcaaaattattggcgatatgcctatctat
gtagctaaagacagtgttgaagtctggactatgcctgaactctttaagatggatgatgac
ttgcagcctttgtcggttgctggctgtccacccgatgaatttagtgatgagggtcagttg
tggggaaatcctatttatgattggaaaaagcatcgagaaacaggctttgcttggtggatt
tatcgtattcaagaaagttttaagatctatgatatcttacggatagatcactttaaaggt
ttctcagattattgggaaattaaaggtaattccaaaactgcaaaaaatggcagctggcat
ccaggacctggtattgctctctttagggctgttcaaaatgttttgggtgatctgccaatt
attgcagaggatttgggttacgtagatgatagagccagacagcttctaaaagaaacaggc
tttccgggcatgaaaattttagaatttggtttctatgatttaagcggccgcagtgttgat
attccccaccattatgttcaaaacagtgttgcttatattgggacgcatgataatgatgtt
gtcaatggttggtatgatcgtcttactgttgagcaagaagaatttgtggatgcttatact
aatcgtaagccaattgagccggttaatcaggctatgcttagactgctcttttcaactgtc
agcaatacagctattttaaccatgcaggatttgctcaataagccagccagctctagaatg
aataccccatcaacaatcggtggtaactggcaatggcggatgagagcaaaagatttaaca
caagataaaatagactttttaagtaaattaacgaaactttatcaaagaggaaatgaagaa
aatgacacaaaaaacaaaacaattcagtaa

DBGET integrated database retrieval system