KEGG   Streptococcus mutans GS-5: SMUGS5_07045Help
Entry
SMUGS5_07045      CDS       T02185                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smut  Streptococcus mutans GS-5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smut00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1492687..1494216)
Genome map
AA seq 509 aa AA seqDB search
MEKRASGILMHISSLPGKFGIGTFGQEAYDFVDFLKKTGQTYWQLLPLTTTSYGDSPYQS
FSAVAGNVNFIDFKKLQEAGLLDEDDYNSVSFGEDEEIVDYALLFKVRRPILEKAVINFL
ADKTNLKKLSLFEEKNETWLDDYAEFMAIKEHFGNKSLQEWGDKKAIRRDEERLVRYRHL
LADEISYHKVTQYFFFEQWLALKAYANKNNIKIIGDMPIYVAKDSVEVWTMPELFKMDDD
LQPLSVAGCPPDEFSDEGQLWGNPIYDWKKHRETGFAWWIYRIQESFKIYDILRIDHFKG
FSDYWEIKGNSKTAKNGSWHPGPGIALFRAVQNVLGDLPIIAEDLGYVDDRARQLLKETG
FPGMKILEFGFYDLSGRSVDIPHHYVQNSVAYIGTHDNDVVNGWYDRLTVEQEEFVDAYT
NRKPIEPVNQAMLRLLFSTVSNTAILTMQDLLNKPASSRMNTPSTIGGNWQWRMRAKDLT
QDKIDFLSKLTKLYQRGNEENDTKNKTIQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgcgcaagtggtatcctgatgcatatcagttctctaccgggaaaatttgga
attggtacttttgggcaggaagcttatgattttgttgatttcctaaaaaaaacaggtcaa
acatattggcagctcttacccttaacgacaacgagttatggtgattctccttaccaatct
ttttctgccgttgctggtaatgtgaattttattgattttaagaaattacaagaagctggc
ttattggacgaggatgactataattctgtttcttttggagaagacgaagaaattgttgat
tatgctctattatttaaagtacgtcggccaattttggaaaaggctgttatcaattttctg
gcagacaagactaatctgaaaaaattatctctgtttgaagaaaaaaatgaaacttggctt
gatgactatgctgaatttatggccatcaaggagcattttggcaataagtctttgcaagag
tggggcgataaaaaggctattcgccgtgatgaggagcgtttggtacgttatcgtcatttg
ttggccgatgaaattagctaccataaggttacacagtacttcttcttcgaacaatggctg
gcgctgaaagcttatgctaataaaaataatatcaaaattattggcgatatgcctatctat
gtagctaaagacagtgttgaagtctggactatgcctgaactctttaagatggatgatgac
ttgcagcctttgtcggttgctggctgtccacccgatgaatttagtgatgagggtcagttg
tggggaaatcctatttatgattggaaaaagcatcgagaaacaggctttgcttggtggatt
tatcgtattcaagaaagttttaagatctatgatatcttacggatagatcactttaaaggt
ttctcagattattgggaaattaaaggtaattccaaaactgcaaaaaatggcagctggcat
ccaggacctggtattgctctctttagggctgttcaaaatgttttgggtgatctgccaatt
attgcagaggatttgggttacgtagatgatagagccagacagcttctaaaagaaacaggc
tttccgggcatgaaaattttagaatttggtttctatgatttaagcggccgcagtgttgat
attccccaccattatgttcaaaacagtgttgcttatattgggacgcatgataatgatgtt
gtcaatggttggtatgatcgtcttactgttgagcaagaagaatttgtggatgcttatact
aatcgtaagccaattgagccggttaatcaggctatgcttagactgctcttttcaactgtc
agcaatacagctattttaaccatgcaggatttgctcaataagccagccagctctagaatg
aataccccatcaacaatcggtggtaactggcaatggcggatgagagcaaaagatttaaca
caagataaaatagactttttaagtaaattaacgaaactttatcaaagaggaaatgaagaa
aatgacacaaaaaacaaaacaattcagtaa

DBGET integrated database retrieval system