KEGG   Streptococcus mutans GS-5: SMUGS5_08430Help
Entry
SMUGS5_08430      CDS       T02185                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
smut  Streptococcus mutans GS-5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smut00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SMUGS5_08430
Enzymes [BR:smut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SMUGS5_08430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1752568..1754931
Genome map
AA seq 787 aa AA seqDB search
MTYYFSGTIDRVIFENTSNFFKIILLEIDDTDSDFDDFEIIVTGTIADVIEGENYTFWGE
LTQHPKYGQQLKVERYQRAKPSSAGLIKYFSSQHFKGIGKKTAEKIIHLYGDDPIDNILE
DPDKLESISGLSKANRENLVSKLRLNYGAEQILAKLAEYGLNNKTAVQIFERYKEESLTV
ITENPYQLVEDIQGIGFKMADKLAEQVGINSDAPQRFRAALVHTLLETSIDKGDTYIEAK
ELLEKSLFILEEVRQVELDPSQIAQELTQLISEDKVQNIGTKIFDNTLFYAESGIHKHLT
RILDRPLEKEISSQDIQTEIKHIQAEFNINYDKAQKNAIQKAIQSKVFLLTGGPGTGKTT
VINGIIKAYANLHQIDLQKSDRPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDSEY
QALDDFLDCDLIIIDEFSMVDTWLANQLFSAIASNTQVIIVGDSDQLPSVGPGQILADLL
KINRLPQVSLTKIFRQSEDSTIVTLANQIRQGRLPTDFTAKKADRSYFEAQSTHIPQMIQ
KIVSSALKSGIDAQEIQILAPMYRGQAGITHLNKLMQDLLNPLNNQLEFQFNDLHFRKGD
KVLHLINDAQINVFNGDIGYITDLIPAKYTESKQDEMILDFDGTEINYPRNEWLKITLAY
AMSIHKSQGSEFKVVILPVTRQSGRLLQRNLIYTAITRSKSKLVMLGEIAAFDNAIKNEG
TKRKTYLIERFKKDECSGHHNTEKNKQGVKESAAILKEDFILTERNILTIDPMIGLSQAD
IDLFFKK
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgacctattacttttcaggcaccattgaccgtgttatttttgaaaataccagcaatttt
tttaaaattattcttctggaaattgacgatactgacagcgattttgatgattttgaaatt
attgtgacaggtactattgctgatgttattgaaggagaaaactatactttttggggtgaa
ttgacccagcatcctaaatatggacagcagttaaaagtggaaagataccagcgtgctaaa
ccctcttctgctggtctgattaagtatttttccagtcagcatttcaagggaatcgggaaa
aaaacagccgaaaaaattattcacttatatggtgatgaccctattgataatattctggaa
gatcctgataagttagaaagcattagtggactttctaaggctaatagagaaaatttagtt
agtaaacttcgtcttaactacggtgctgaacagattctggcaaaattagcagaatatgga
ttaaataacaaaacagctgttcaaatttttgaacgctataaagaagaaagtttgactgtt
attactgaaaatccttatcaactggttgaggacattcaaggcattggattcaaaatggct
gacaaattagcagaacaagtaggtattaacagcgatgctcctcagcgttttcgtgctgct
cttgttcatactcttttagaaacctctattgacaaaggtgacacctatattgaagccaaa
gaattactcgaaaaatctctttttattcttgaagaggtgagacaagtcgaactggatccc
agtcaaattgctcaggaactgacacaattaatctccgaagataaggtacaaaatattggt
actaaaatctttgataatacgcttttttatgccgaatcaggcattcataagcatcttacc
cgcattctggatagaccacttgaaaaagagatcagcagccaagacattcaaactgaaatt
aaacatattcaagcagaatttaatattaactatgacaaagcacaaaaaaatgctatccaa
aaagccatccaaagcaaggttttccttttaacaggcggtccaggaaccggaaaaacgact
gtcatcaatggaattattaaggcttatgctaatttgcatcaaattgacctgcaaaaaagt
gaccgacctattattctggctgccccgactggtcgtgctgctagacggatgaatgagcta
acaggtttacctagtgccaccattcaccggcatttaggacttaatggtgatagtgaatat
caggcacttgatgattttctggattgtgatctcattattattgacgagttttctatggtt
gatacttggctagccaatcaattgtttagtgctattgcttcaaatacacaagttatcatt
gttggtgatagcgatcagctcccatccgtcggtccaggtcaaattttggctgatttactg
aaaataaatagattaccgcaagtttccttaactaaaatattcaggcaatctgaggactca
actattgtcacacttgccaaccagattcgccaaggtcgtcttccaactgacttcacagct
aaaaaggctgaccgttcttattttgaagcacagagcactcacattccgcaaatgattcaa
aagattgtcagttctgcccttaaaagtggtatagatgctcaggaaatacagattttagca
ccgatgtatcgtgggcaagcaggtattacgcatcttaataaactgatgcaagatttgctc
aatcctttaaataaccagttagaatttcaatttaatgaccttcattttcgtaagggcgat
aaagtacttcatcttatcaacgatgcgcaaattaacgtgtttaatggtgacattgggtac
attactgatcttattcctgcaaaatatacagagtccaaacaagatgaaatgattctggat
tttgatggaactgagattaactatcctcgcaatgaatggttgaaaataacactcgcttac
gctatgagtatccacaaatctcaaggcagtgaatttaaagtagttattcttcctgtcaca
cgccaaagcggcagacttttgcaacgcaatctcatttatacagctatcacacgctcaaaa
agcaaacttgtcatgttgggagaaattgcagcctttgacaacgccatcaaaaatgaagga
actaaaagaaaaacttatcttattgaacgctttaagaaggatgaatgcagtggccaccat
aacaccgagaaaaataaacaaggagtaaaagaaagtgcagctatattaaaagaagatttt
attttgacagaaagaaatatcttaacgattgaccctatgattggcttatctcaagctgac
attgacttattttttaagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system