KEGG   Streptococcus mutans GS-5: SMUGS5_08675Help
Entry
SMUGS5_08675      CDS       T02185                                 

Definition
peptidase, AtmC, ArgE/DapE/Acy1 family protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smut  Streptococcus mutans GS-5
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smut01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:smut00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1799484..1800857)
Genome map
AA seq 457 aa AA seqDB search
MAFSSEQEQIAKFWQDEVAQHYFEVLRTLISKKSIFAQQIGLQDVAGYLGEIFANVGAEV
TIDETYTAPFVIAKFKSSKPQAKTIIFYNHYDTVPADNDQIWTDNPFKLTLRKGYMYGRG
VDDDKGHITARLTAVRKYIREVGDLPVNVTFIIEGAEESASTDLDKYLKKYADSLLPADV
LIWEQGVKNSQGQLEITGGNKGIITFNLSVSSAEVDIHSKYGAVIESAAWYLLNAISSMR
ADDGQILIDGIYDQVLKPNERELDLVERYALENSEGLRKVYGLKLPTLKKERRDFLKTYF
FEPALSIEGLSSGYQGQGVKTILPSAASAKMEMRLVPGLSPQYVFEKINSHLRKLGFEHV
KVTYTLGEESYRSDMSAPAILTIIDLAKQFYEAGVSVLPTAAGTGPMHTVYDALGIPMLA
FGLGNPNSRDHGGDENVNLADYYTHIELIKELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcaagtgaacaagagcaaattgctaaattttggcaggatgaagttgctcag
cattattttgaggttttacggaccttaatttccaaaaaatctatttttgcacaacagata
ggcctgcaggatgttgcaggctatttgggcgaaatttttgccaatgtcggtgctgaagtg
acaattgatgaaacctatacggctccttttgttattgctaaatttaaaagttccaaacct
caggctaaaaccattattttttataaccattatgatacagtacctgcagataatgatcag
atttggacagataatccctttaaactgactttaagaaaggggtatatgtatggccgcggt
gttgatgatgacaaagggcatattacagctcgtttgacagctgttcgaaagtatattcgt
gaggttggggaccttcctgttaatgttacttttataatagaaggagctgaagaatctgct
tcaacagatcttgacaagtatttaaaaaaatatgcggatagtttgcttcctgcagatgtt
ttgatttgggaacaaggtgttaaaaatagtcagggtcagttagaaattacaggtggtaat
aaaggtattattacttttaatctttctgtatccagtgcagaggttgatattcactcaaaa
tatggtgcggttattgaatcggcagcatggtatctcttaaatgcaatttccagtatgcga
gcagatgatggtcagattttaatcgatggtatttatgatcaggtcttgaagcccaatgag
cgtgaattggatttagtagagcgttatgctcttgaaaatagtgaaggtttgcgcaaagtt
tatggtttaaaattaccaactttaaaaaaagagcgtcgtgattttcttaaaacctatttt
tttgaacccgccttatccatagaaggactttcttctggttatcaagggcaaggtgtgaaa
acaattctgccttctgctgccagtgctaagatggaaatgcgtttagttcccggtctcagt
ccccagtacgtttttgaaaagattaatagtcatttgagaaaattaggctttgaacatgtt
aaggtaacctataccttaggcgaagaatcttatcgcagtgatatgagtgctccggctatt
ttgaccattattgacttggctaagcaattttatgaagctggcgtatctgttctgcccact
gctgctggtacaggtcctatgcatacggtttatgatgctttgggcattcctatgttagct
tttggacttggcaatcccaatagtcgcgatcacggtggtgatgaaaatgttaatttagca
gactattatacccatattgaattaattaaggagttaattagaagttatgagtaa

DBGET integrated database retrieval system