KEGG   Serratia marcescens WW4: SMWW4_v1c01600Help
Entry
SMWW4_v1c01600    CDS       T02448                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
smw  Serratia marcescens WW4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMWW4_v1c01600 (bcsZ)
Enzymes [BR:smw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SMWW4_v1c01600 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170029..171132
Genome map
AA seq 367 aa AA seqDB search
MLQRLSLGMLLLCAFSAAAACEWPGWQQYKQFYISPQGRVIDPSSPNKITTSEGQSYGLF
FALVANDRPTFDQLLTWTENNLAAGDLSARLPAWLWGESDDKQWKVLDANSASDADLWIA
YNLLEAGRLWKSRRYQTLGTLLLQRIGREEVADIPGLGLMLLPGKVGFVAEDRWRLNPSY
LPPQLLARFAALNGPWRAMREVNQRLWLDTAPHGFSPDWVVWRVGAGWQPDTVKPNVGSY
DAIRVYLWAGMLADDDEHKAALLERFQPMAQFTAKQGVPPEKTDTASGKTTGDGPVGFSA
SVLPMLATQAEALAVQRQRISEHPPGDDAYFSASLTLFGQGWDQQRYRFNRQGELQPSWD
GQCTTSK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaacgcctgtcgctcggcatgctgctgctgtgcgctttcagcgcggcggcggcc
tgcgagtggccgggctggcaacagtacaagcagttctacatcagcccacagggacgggtg
atcgacccgagcagcccgaacaaaatcaccacctctgagggccagagttacggcctgttc
ttcgccctggtggccaatgaccggccgaccttcgaccagctgttgacctggacggagaac
aatctggcggcgggcgatctcagcgcccgtttgcccgcctggctgtggggcgagagcgac
gataagcagtggaaggtgctggacgccaactcggcgtcggacgccgatctgtggatcgcc
tacaacctgctcgaagccggccgcctgtggaaaagccggcgttatcaaaccctggggacg
ctgctgctgcaacgcatcggccgcgaggaagtggccgacattcccggcctgggcctgatg
ctgctaccgggcaaagtcgggttcgtggcggaagatcgctggcggctgaatcccagctac
ctgccgccgcagctgttggcgcgttttgcggcgctgaacggcccatggcgcgcgatgcgc
gaggtcaatcaacggctgtggctggacaccgcgccgcacggtttctcaccggattgggtg
gtgtggcgggtcggtgccggttggcagccggacaccgtcaagccgaacgtcggcagctac
gacgccattcgggtttatctgtgggccggcatgctggcggacgacgatgaacacaaggcg
gcactgcttgaacgcttccagccgatggcgcagttcactgccaaacagggcgttccgccg
gagaaaaccgataccgccagcggcaaaaccaccggagacggcccggtcggtttctccgct
tctgtgctgccgatgctggcgacgcaggctgaagcgctggcggtgcagcggcagcgcatc
agcgagcacccgccgggtgacgacgcctatttcagcgcttcgctgacgctgttcggtcag
gggtgggatcaacaacgttatcgctttaatcgtcagggtgaattgcaaccctcgtgggac
ggccaatgcacaacttcaaaataa

DBGET integrated database retrieval system