KEGG   Serratia marcescens WW4: SMWW4_v1c01600Help
Entry
SMWW4_v1c01600    CDS       T02448                                 

Gene name
bcsZ
Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
smw  Serratia marcescens WW4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
170029..171132
Genome map
AA seq 367 aa AA seqDB search
MLQRLSLGMLLLCAFSAAAACEWPGWQQYKQFYISPQGRVIDPSSPNKITTSEGQSYGLF
FALVANDRPTFDQLLTWTENNLAAGDLSARLPAWLWGESDDKQWKVLDANSASDADLWIA
YNLLEAGRLWKSRRYQTLGTLLLQRIGREEVADIPGLGLMLLPGKVGFVAEDRWRLNPSY
LPPQLLARFAALNGPWRAMREVNQRLWLDTAPHGFSPDWVVWRVGAGWQPDTVKPNVGSY
DAIRVYLWAGMLADDDEHKAALLERFQPMAQFTAKQGVPPEKTDTASGKTTGDGPVGFSA
SVLPMLATQAEALAVQRQRISEHPPGDDAYFSASLTLFGQGWDQQRYRFNRQGELQPSWD
GQCTTSK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaacgcctgtcgctcggcatgctgctgctgtgcgctttcagcgcggcggcggcc
tgcgagtggccgggctggcaacagtacaagcagttctacatcagcccacagggacgggtg
atcgacccgagcagcccgaacaaaatcaccacctctgagggccagagttacggcctgttc
ttcgccctggtggccaatgaccggccgaccttcgaccagctgttgacctggacggagaac
aatctggcggcgggcgatctcagcgcccgtttgcccgcctggctgtggggcgagagcgac
gataagcagtggaaggtgctggacgccaactcggcgtcggacgccgatctgtggatcgcc
tacaacctgctcgaagccggccgcctgtggaaaagccggcgttatcaaaccctggggacg
ctgctgctgcaacgcatcggccgcgaggaagtggccgacattcccggcctgggcctgatg
ctgctaccgggcaaagtcgggttcgtggcggaagatcgctggcggctgaatcccagctac
ctgccgccgcagctgttggcgcgttttgcggcgctgaacggcccatggcgcgcgatgcgc
gaggtcaatcaacggctgtggctggacaccgcgccgcacggtttctcaccggattgggtg
gtgtggcgggtcggtgccggttggcagccggacaccgtcaagccgaacgtcggcagctac
gacgccattcgggtttatctgtgggccggcatgctggcggacgacgatgaacacaaggcg
gcactgcttgaacgcttccagccgatggcgcagttcactgccaaacagggcgttccgccg
gagaaaaccgataccgccagcggcaaaaccaccggagacggcccggtcggtttctccgct
tctgtgctgccgatgctggcgacgcaggctgaagcgctggcggtgcagcggcagcgcatc
agcgagcacccgccgggtgacgacgcctatttcagcgcttcgctgacgctgttcggtcag
gggtgggatcaacaacgttatcgctttaatcgtcagggtgaattgcaaccctcgtgggac
ggccaatgcacaacttcaaaataa

DBGET integrated database retrieval system