KEGG   Serratia marcescens WW4: SMWW4_v1c02000Help
Entry
SMWW4_v1c02000    CDS       T02448                                 

Gene name
pldA
Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
smw  Serratia marcescens WW4
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:smw00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:smw00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:smw00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:smw00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:smw00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220567..221445
Genome map
AA seq 292 aa AA seqDB search
MRILSGIVSATLLMPALALAEEAKEQQIHDKPTVRGSIIANLLQEHDNPFTLYPYDPNYL
LYTDTSDINKEAIKTYNWADKARKDEVKYQLSLAFPLWRGIAGDNSVLGASYTQRSWWQL
SNRGESSPFRETNYEPQLFVGWATDYRFAGWTLRDVEIGVNHQSNGRSDPTSRSWNRGYA
RLMAQNGNWQVDLKPWFRFSESSSNDDNPDITKYMGYYRLKVGYAWGDSVFSVDSHYNWN
SGYGGAELGWSYPITRNVRFYTQVFSGYGESLIDYNFRQTRVGVGVMLNDIM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattttgtcagggatcgtttccgccacgctgttgatgccggcgctggcattggct
gaggaagccaaagagcagcagattcacgataagccgacggtgcgcggcagcattatcgcc
aacctgctgcaggagcacgataatccattcacgctgtatccttacgatcccaattacctg
ctgtacaccgacaccagcgatatcaacaaagaagccatcaagacgtacaactgggccgac
aaggcgcgcaaggacgaggtgaaataccagcttagcctggcgtttccgctgtggcggggc
attgccggcgacaactcggtgctcggcgcgtcttatactcagcgctcctggtggcaattg
tccaaccgcggcgagtcttcgccgttccgcgagaccaactacgagccgcagctgttcgtg
gggtgggcgaccgattaccgctttgccggctggacgctgcgcgatgttgaaatcggcgtt
aaccatcagtctaacggccgctcagatccgacgtcgcgcagctggaatcgcggctatgcg
cggctgatggcgcaaaatggcaactggcaggtggatctcaagccctggttccgcttctcg
gagagctcgagcaacgacgacaacccggacatcaccaaatacatgggatactaccggttg
aaggtcggttacgcctggggcgacagtgtgttcagcgtcgacagccactacaactggaac
agcggctacggcggcgcggaactgggctggagttacccgatcacccgcaacgtgcgtttc
tatacccaggtgttcagcggctacggcgaatcgctgatcgactacaacttccggcagaca
cgggtgggcgttggtgtcatgctgaacgatattatgtaa

DBGET integrated database retrieval system