KEGG   Serratia marcescens WW4: SMWW4_v1c05320Help
Entry
SMWW4_v1c05320    CDS       T02448                                 

Gene name
yqeF
Definition
(GenBank) putative acyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smw  Serratia marcescens WW4
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMWW4_v1c05320 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SMWW4_v1c05320 (yqeF)
   00640 Propanoate metabolism
    SMWW4_v1c05320 (yqeF)
   00650 Butanoate metabolism
    SMWW4_v1c05320 (yqeF)
  Lipid metabolism
   00071 Fatty acid degradation
    SMWW4_v1c05320 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SMWW4_v1c05320 (yqeF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMWW4_v1c05320 (yqeF)
   00310 Lysine degradation
    SMWW4_v1c05320 (yqeF)
   00380 Tryptophan metabolism
    SMWW4_v1c05320 (yqeF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMWW4_v1c05320 (yqeF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMWW4_v1c05320 (yqeF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMWW4_v1c05320 (yqeF)
Enzymes [BR:smw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMWW4_v1c05320 (yqeF)
Exosome [BR:smw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMWW4_v1c05320 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
606043..607227
Genome map
AA seq 394 aa AA seqDB search
MQQREVVIVAATRTPVGSFHGALAPLTAVELGTAAVQGLLAQSGVPPQQIDEVILGQVLT
AGCGQNPARQTALNAGLPVTTPALTINKVCGSGLKAVHLAVQAIRSGDADAVIAGGQESM
SQSPYLMAGARAGLRLGHAQMMDSVIHDGLWDAFNDYHMGITAENLAEKYAISREEQDRF
ALRSQQKALAAQQAGRFVQEITPVTVPQPKGEALRVERDQQPRDTSLEALARLRPAFRKE
GTVTAGNASSLNDGAAVVLLMSAEKAAALRLPVLARIAGYASSGVDPAIMGIGPAPAARR
CLEKAGWRLEEVDLIEANEAFAAQALAVGKELGWEAERVNVNGGAIALGHPIGASGCRIL
VSLLFEMQRREVNKGLAMLCIGGGQGVALAVERP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaacgtgaagtggtgatcgtggcggcgacgcgcacgccggtcggcagttttcac
ggcgcgctggcgccgttgacggcggtggaactgggcacggcggcggtgcaggggctgctg
gcgcaaagcggcgtgccgccgcagcagatcgatgaagtgatcctcggccaggtgctgacc
gccggctgcgggcagaatccggcgcgccagaccgcgctcaacgccgggctgcccgttacg
acgccggcgctgaccatcaacaaggtgtgcggctccggtttgaaggcggtgcatctggcg
gtgcaggcgatccgcagcggtgacgccgacgcggtgatcgccggcggtcaggagagcatg
agccagtcgccttacctgatggccggcgcgcgcgccggtctgcgcctcggtcacgcgcag
atgatggacagcgtgatccacgatggcctgtgggacgcgttcaacgactatcacatgggc
atcaccgccgagaacctggcggagaaatacgccatcagcagagaagaacaagacaggttc
gcgctgcgctcgcagcagaaggcgctggcggcgcagcaggccgggcgtttcgtgcaggag
atcacgccggtgacggtgccgcagcccaagggcgaggcgctgcgggtcgagcgtgaccaa
cagccgcgcgacaccagcctggaggcgctggcgcggctgcgcccggcgtttcgcaaagag
ggcacggtgaccgccggcaacgcctcgtcgctcaacgacggcgccgccgtggtgctgctg
atgagcgcggaaaaagccgccgcgctgcgtttgccggtgctggcgcgcatcgccggttac
gcctcgtcgggcgtcgatccggcgatcatgggcatcggcccggcgccagccgcgcgccgc
tgcctggaaaaagccggttggcggctggaggaggtcgatctgatcgaagccaacgaagcc
ttcgccgcgcaggcgctggcggtgggtaaagaactgggctgggaggcggagcgggtcaac
gtcaacggcggagcgatcgcgctggggcatccgatcggcgcgtccggctgccgcattttg
gtgtcgctgctgttcgaaatgcagcgccgcgaggtgaacaaggggctggcgatgctgtgc
atcggcggtgggcagggggtggcgctggcggtagagcgcccgtaa

DBGET integrated database retrieval system