KEGG   Serratia marcescens WW4: SMWW4_v1c06530Help
Entry
SMWW4_v1c06530    CDS       T02448                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
smw  Serratia marcescens WW4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SMWW4_v1c06530 (deoA)
Enzymes [BR:smw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SMWW4_v1c06530 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722997..724319
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLSEAEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALT
MAMRDSGTVLDWKSLALNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFNIFPDDNAFRKIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSQDLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTLALCVEMLLSGGLANDEADARAKL
QAVLDNGKAAEVFGRMVAAQQGPIDFVERYDSYLPAATLSKPVYAENPGIISAMDTRALG
MAVVSLGGGRRRASDAIDYSVGLTEVARLGDKVDAQQPLAMIHANDEESWQQAADAVRSA
MTLSDKAPEATPVVYKRVTE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctggctcaagaaattattcgtaagaaacgcgacggccagccgttaagcgaagcg
gaaatccgctttttcatcaacggtattcgcgacaatgtggtgtcggaagggcagatcgcc
gcgctggcgatgaccatttatttccatgacatgagcatgccggagcgcgtggcgctcacc
atggcgatgcgcgattccggcaccgtgctggactggaagagtttggcgctgaacggcccg
atcgtcgacaagcattcgaccggcggcgtgggcgacgtgacctcgctgatgctcggcccg
atggtggcggcctgcggcggctatgtgccgatgatctccggccgcggcctgggtcatacc
ggcggcacgctggacaaactggaagccattccgggcttcaatattttcccggacgataac
gccttccgtaaaatcattcaggacgtcggcgtggcgatcatcggccagaccagctcgctg
gcgccggcggacaaacgtttttacgccacccgcgacatcaccgccaccgtggattctatc
ccgctgatcactgcctccattctggccaagaaactggcggaagggctggatgcgctggtg
atggacgtgaaggtcggttccggcgcctttatgccgacctatgccctgtcgcaagatttg
gcgcaggcgatcgtcggcgtggccaacggcgcgggctgcaagaccaccgcgctgctgacc
gacatgaaccaggtgctggcctccagcgccggcaatgcggtggaagtgcgcgaagcggtg
cgtttcctgaccggtgaataccgcaacccgcgcctgctggaagtgacgctggcgctgtgc
gtggagatgctgctgtccggcggcctggcgaatgacgaggccgatgcgcgtgccaaactg
caggcggtgctggacaacggcaaggcggcggaagtgtttggccgcatggtggcggcgcag
caagggccgatagacttcgtcgaacgttatgatagctatctgccggcggcaacgctgagc
aagccggtgtatgctgaaaatccgggcatcatcagcgccatggatacccgcgcgctgggc
atggcggtggtttcgctgggcggcggccgccgccgggcgagcgacgccatcgattacagc
gtcggtctgaccgaggtggcgcgcctgggtgataaggtggatgcccagcagccgctggcg
atgatccacgccaacgatgaagagagctggcagcaggcggccgatgcggtgcgtagcgca
atgacgctgagtgacaaggcgccggaagcgacgccggtagtgtataagcgcgtcacggaa
taa

DBGET integrated database retrieval system