KEGG   Serratia marcescens WW4: SMWW4_v1c06770Help
Entry
SMWW4_v1c06770    CDS       T02448                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smw  Serratia marcescens WW4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMWW4_v1c06770 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMWW4_v1c06770 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMWW4_v1c06770 (thrC)
Enzymes [BR:smw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMWW4_v1c06770 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
750713..752002
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPAFELTEIDQLLEQDFVTRSSRILS
AFIGEEVPEAALKKRVQAAFEFPAPVAKVTEDVSCLELFHGPTLAFKDFGGRFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPQGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDQELKDALHLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLTSGQWQPHATVATLSNA
MDVSQPNNWPRVEELFRRKVWQLKELGHAAVSDETTKDTMRELAELGYISEPHAAIAYRA
LRDQLQEGEFGLFLGTAHPAKFKESVEAILGQELPLPKALALRADLPLLSHTLPASFGEL
RKFLMALPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaggatcacaacgagcaggtcagcttcgcgcaggcgatcaaa
caaggcctgggcaagcagcaggggctgttcttcccgctggagctgccggcgttcgaactg
accgagatcgaccagctgctggagcaggactttgtcacccgcagcagccgcattctgtcg
gcctttatcggcgaagaagtgccggaagcggcgctgaagaaacgcgtacaggccgccttt
gagtttccggcgccggtagcgaaagtgacggaagacgtctcctgcctggagctgttccac
ggcccgacgctggcgttcaaagacttcggcggccgctttatggcgcagatgctggcggaa
gtggccggcgatcagccagtgaccattttgaccgccacctccggcgacaccggcgccgcc
gtggcgcacgccttctatggcctgaagaacgttcgggtggtgatcctttacccgcagggc
aaaatcagcccgctgcaggaaaagctgttctgcaccctgggcggcaatattcacaccgtg
gcgatcgacggcgacttcgacgcctgtcaggcgctggtgaaacaggcgttcgacgatcag
gaattgaaagacgcgctgcacctgaactcggccaactcgatcaacatcagtcgcttgctg
gcgcagatttgctactacttcgaagcggtggcgcagctgccgcaggaagcgcgcaatcag
ctggtgatttcggtgccgagcggcaacttcggcgatctgaccgccgggctgctggccaaa
tcgctgggcttgccggtgaagcgcttcatcgccgccaccaacgccaacgacaccgtgccg
cgcttcctgaccagcggccagtggcagccgcacgctacggtcgcgacgctgtccaacgcc
atggacgtgagccagccgaacaactggccgcgcgtggaagagctgttccgtcgtaaggtc
tggcaactgaaagagctggggcacgcggcggtcagcgacgagaccaccaaagacaccatg
cgtgaactggccgagctgggctatatctccgaaccgcatgcggccatcgcttaccgcgcg
ctgcgcgatcagctgcaggaaggggagttcgggctgttcctcggcacggcgcatccggcc
aagtttaaagagagcgtggaagcgatcctcggccaggaactgccgttgccgaaagcgctg
gcgctgcgggccgatctgccgctgctgtcgcacacgctgccggccagtttcggcgagctg
cgcaaattcctgatggcgctgccggcctga

DBGET integrated database retrieval system