KEGG   Serratia marcescens WW4: SMWW4_v1c15070Help
Entry
SMWW4_v1c15070    CDS       T02448                                 

Gene name
phoA
Definition
bacterial alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
smw  Serratia marcescens WW4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMWW4_v1c15070 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SMWW4_v1c15070 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMWW4_v1c15070 (phoA)
Enzymes [BR:smw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SMWW4_v1c15070 (phoA)
Exosome [BR:smw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMWW4_v1c15070 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649218..1650645)
Genome map
AA seq 475 aa AA seqDB search
MQPAVSLIAGAVLSALLCSSAIAAETSANADGLTERAAHGNLAEPGGARRLAGDQTAALK
ASLSDKTAKNVILLIGDGMGDSEITAARNYAEGAGGYFKGIDALPLTGQYTHYSLDKKTH
KPDYVTDSAASATAWTTGVKTYNGALGVDVNGKDQPTLLEIAKAAGKATGNVSTAELQDA
TPAALVSHVTSRKCYGPEETSEKCAANALENGGRGSITEQLLKTRADVTLGGGAKSFNQL
AKSGEWQGKSLKDQAAAQGYQWVSNADELQAVTLANQQKPLLGLFADGNMPVRWLGPKAS
YHGNLDKPAVTCENNPARTAATPTLAAMTEKAIALLKDNPNGFFLQVEGASIDKQDHAAN
PCGQIGETVDLDEAVQKALAFARADGNTLVIVTADHAHSSQIVAADAKAPGLTQMLTTKD
GAPMTLSYGNSEEESQGHTGTQLRVAAYGPHAANVVGLTDQTDLFFTMRDAMGIK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgctgtatccctgatcgccggcgccgtgctgtccgccctgctctgttcctcc
gccatcgcggcggaaacctcggccaatgccgatggcctgaccgaacgcgccgcacacggc
aacctcgccgaaccgggcggcgcccgtcgtctggccggcgatcagaccgccgcgctgaag
gcgtcgctgtcggacaaaacagcgaaaaacgtgattctgctgatcggcgacggcatgggg
gattccgagatcaccgccgcgcgcaattacgctgaaggcgcaggcggttacttcaagggc
atcgacgccctgccgctgaccgggcaatacacccactactcgctggacaagaaaacccac
aagccggattacgtgaccgattccgccgcctccgccaccgcctggaccaccggggtgaaa
acctataacggcgcgctcggcgtggacgtgaacggcaaagatcagccgacgctgctggag
atcgccaaggcggccggcaaggccaccggcaacgtctccaccgccgagttgcaagacgct
acgccggcggcgctggtgtcgcacgtcacctcgcgcaaatgctacggcccggaggaaacc
agcgagaaatgcgccgctaacgcgctggaaaacggcggccgcggctccatcaccgagcag
ttgctgaaaacccgcgccgacgtcacgctgggcggcggcgcgaagtccttcaaccagctg
gcgaaaagcggcgaatggcaaggaaaatcgctgaaagatcaggcggcggcgcagggttac
cagtgggtgagcaacgcggatgagctgcaggccgttacgctggccaaccagcaaaaaccg
ctgctgggtctgttcgccgacggcaacatgccggtgcgctggctggggccgaaagccagc
tatcacggcaacctcgacaagccggcggtaacctgcgaaaacaacccggcgcgcaccgcg
gccacgccaacgctggcggcgatgaccgaaaaagcgatcgcactgttgaaagataacccg
aacggcttcttcctgcaggtagagggcgcgtcgatcgataagcaggatcacgccgctaac
ccgtgcgggcagattggtgaaaccgtcgatctggacgaagcggtgcaaaaagcgctggcc
ttcgcccgcgccgacggcaacacgctggtgatcgtcaccgccgaccatgcacactccagc
cagatcgtcgccgccgacgccaaagcgccgggcctgacccagatgctgaccaccaaagac
ggcgcgccgatgaccctcagctacggcaactcggaagaagagtcgcaggggcacaccggc
acccaattgcgcgtcgcggcctacggcccgcacgccgccaacgtggtgggattgaccgat
cagaccgatctgttcttcaccatgcgcgatgcgatgggcatcaagtaa

DBGET integrated database retrieval system