KEGG   Serratia marcescens WW4: SMWW4_v1c15440Help
Entry
SMWW4_v1c15440    CDS       T02448                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smw  Serratia marcescens WW4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1684760..1685425
Genome map
AA seq 221 aa AA seqDB search
MTSLSKEAALVHAALEERGLETPLRGEVLDRETRKRRIKEHMTEIMQLLNLDLSDDSLAE
TPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHQG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattaagtaaagaagccgcgctggtgcatgcggcactggaagagcgtggtctg
gagacaccgctgcgcggggaagtgctggatcgcgaaacgcgcaagcgtcgcatcaaagag
cacatgaccgaaatcatgcagctgctgaatctcgatctgtctgacgacagcctggcggaa
acgccgcatcgcatcgccaaaatgtatgtcgacgagatcttctccgggctggactacgcc
aacttcccgaaaatcaccgtcatcgagaacaagatgaaggtggatgagatggtgacggtg
cgcgatatcacgctgaccagcacctgtgaacaccacttcgtgaccatcgacggcaaggct
accgtggcctatatcccgaaagactcggtgatcggcctgtcgaagatcaaccgcatcgtg
cagttcttctcccagcgtccgcaggtgcaagagcgcctgacccagcagatcctggtggcg
ctgcagaccctgctcggcaccaataacgtggcggtatcgatcgatgcggtccattattgt
gtcaaggcgcgcggtatccgcgacgcgaccagcgccaccaccactacctcgctggggggg
ctgttcaagtccagccagaatacccgccaggagttcctgcgtgcggtgcgtcaccaccag
gggtga

DBGET integrated database retrieval system