KEGG   Serratia marcescens WW4: SMWW4_v1c15440Help
Entry
SMWW4_v1c15440    CDS       T02448                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smw  Serratia marcescens WW4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMWW4_v1c15440 (folE)
Enzymes [BR:smw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SMWW4_v1c15440 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1684760..1685425
Genome map
AA seq 221 aa AA seqDB search
MTSLSKEAALVHAALEERGLETPLRGEVLDRETRKRRIKEHMTEIMQLLNLDLSDDSLAE
TPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHQG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattaagtaaagaagccgcgctggtgcatgcggcactggaagagcgtggtctg
gagacaccgctgcgcggggaagtgctggatcgcgaaacgcgcaagcgtcgcatcaaagag
cacatgaccgaaatcatgcagctgctgaatctcgatctgtctgacgacagcctggcggaa
acgccgcatcgcatcgccaaaatgtatgtcgacgagatcttctccgggctggactacgcc
aacttcccgaaaatcaccgtcatcgagaacaagatgaaggtggatgagatggtgacggtg
cgcgatatcacgctgaccagcacctgtgaacaccacttcgtgaccatcgacggcaaggct
accgtggcctatatcccgaaagactcggtgatcggcctgtcgaagatcaaccgcatcgtg
cagttcttctcccagcgtccgcaggtgcaagagcgcctgacccagcagatcctggtggcg
ctgcagaccctgctcggcaccaataacgtggcggtatcgatcgatgcggtccattattgt
gtcaaggcgcgcggtatccgcgacgcgaccagcgccaccaccactacctcgctggggggg
ctgttcaagtccagccagaatacccgccaggagttcctgcgtgcggtgcgtcaccaccag
gggtga

DBGET integrated database retrieval system