KEGG   Serratia marcescens WW4: SMWW4_v1c19270Help
Entry
SMWW4_v1c19270    CDS       T02448                                 

Gene name
rrrD
Definition
putative lysozyme, DLP12 prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
smw  Serratia marcescens WW4
Brite
Enzymes [BR:smw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SMWW4_v1c19270 (rrrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2109891..2110385
Genome map
AA seq 164 aa AA seqDB search
MNSSLRNKIVAAITGGGGAIAIATAMLGGHDGLEGRRYVAYRDVVGVLTVCDGHTGADII
LGKRYSDAECDALLKSDLQKVARIVDPAIKVKTTETQRAAIYSFSYNVGPYAFIGSTMLK
KLNAGDPAGACGELKRWKYAGGKEWKGLITRREVENTVCTWGQS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaattccagcctgagaaataaaatcgtcgctgccataaccggtggcggcggggcgatt
gcgatcgccactgcaatgctcggcggccacgatgggttagagggccggcggtatgtggcc
tatcgcgacgttgtcggcgttctgacggtctgcgatggacataccggcgccgatattatc
ctcggcaagcgatacagcgacgcagaatgcgatgcgctgttgaaatctgacctgcagaaa
gtcgcacggattgtcgatcctgcgatcaaggtgaaaaccacggaaacccagcgcgccgct
atttactcgttctcgtacaacgtcggcccgtatgcgtttatcggctccacgatgctgaaa
aaattgaatgccggcgacccggccggcgcgtgcggtgaactgaagcgctggaagtatgcc
ggcggcaaagagtggaaagggctgatcacccggcgtgaagtcgaaaacaccgtctgcacc
tggggccaatcatga

DBGET integrated database retrieval system