KEGG   Serratia marcescens WW4: SMWW4_v1c21010Help
Entry
SMWW4_v1c21010    CDS       T02448                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smw  Serratia marcescens WW4
Pathway
smw00052  Galactose metabolism
smw00500  Starch and sucrose metabolism
smw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SMWW4_v1c21010
   00500 Starch and sucrose metabolism
    SMWW4_v1c21010
Enzymes [BR:smw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SMWW4_v1c21010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGE17902
Position
complement(2275230..2276672)
Genome map
AA seq 480 aa AA seqDB search
MNTALAQADHAVEALRAERRDDYYPQFHLAPPAGWINDPNGLICIDGVYHAFFQHHPYSE
HWGPMHWGHATSRDLIRWQHQPIALAPDAPYDQDGCFSGCAVDDNGVLTLIYTGHVWLGE
PGDDSQVREVQCLATSEDGIRFVKHGPVLAPPDGIQHFRDPKVWRENGEWWLVVGAKENG
LGQVRLYRSADLRAWRFDRVLVGAQTAHQGYMWECPDFFPLGEQHLLLFSPQGLAAQGYR
YRNRFQSGYLLGHWRPDGDFRVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHRWAGALTLPRELTLAADGSVRMNPARELAALRRASHSFLAQTLTNQHLPLANDV
QELTLTLRPADNDAERYGLAIGSVARLFVDNQAHRLVLERFHENPALSTCRSVPLPEGDI
LSLRIFIDRSSLEIFVNQGLACLTSRIYPTEGDRRLSLFAEGGRAEFEPITGWQLASIWG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccttagctcaagccgaccatgcggtcgaggccctgcgcgcagagcgccga
gatgattactacccgcagttccatctcgcgccgcccgccggctggatcaacgatcccaac
ggcctgatctgtattgacggcgtctatcatgccttcttccagcatcacccctatagcgaa
cactgggggcccatgcactgggggcacgcgaccagccgcgatctgatccgctggcagcac
cagcccatcgccctggcacccgatgcgccctatgaccaagacggttgcttttccggctgc
gccgtggatgacaacggcgtgctgacgctgatttacaccggccacgtgtggctgggcgag
cccggcgacgacagccaggtgcgggaagtgcaatgtctggccaccagcgaagacggcata
cgcttcgtcaagcacgggccggtgctggccccgccggacggcattcagcatttccgcgat
ccgaaagtctggcgcgagaacggcgaatggtggctggtggtcggcgctaaagaaaacggc
ctgggccaggtacgcctgtaccgttctgcagacctgcgcgcctggcgcttcgatcgggtg
ctggtcggcgcgcaaacggcgcatcaagggtatatgtgggaatgcccggatttcttcccg
ctgggggaacagcacctgctgctgttctcgccgcagggcctggcggcgcagggctaccgc
taccgcaatcgcttccagagcggctatctgctcggccattggcggccggacggcgacttc
agggtgacccagcccttctgcgagctggatgccggccacgatttctatgcgccgcagacc
ttcaccgccgccgacggccgtcggctgctgtttgcctggatggatatgtgggaatcaccg
atgcccagcaaagcgcaccgttgggccggcgccctcaccctgccgcgcgagctgacgctg
gccgccgacggcagcgtccgcatgaacccggcgcgtgaactggcggcgctgcgccgagcg
tcgcactcgtttttggcgcagacgctgaccaatcagcatttgccgctggcgaacgatgtg
caggaactcactctgacattgagaccggccgacaacgacgccgagcgttacgggctggcc
atcgggagtgtagcgcggctgttcgtcgataatcaggcgcaccgactggtactggaacgt
tttcatgaaaaccccgccctgagcacctgccgcagcgtgccgctgccggagggtgacatc
ctgtcgctgcggatctttatcgaccgttcatcgctggagattttcgttaatcagggattg
gcctgcctgaccagccgcatttatccgacggagggagatcgccgcctcagcctgtttgcc
gagggcggacgggcagagttcgagcccatcacaggatggcagctggctagcatctgggga
tag

DBGET integrated database retrieval system