KEGG   Serratia marcescens WW4: SMWW4_v1c27170Help
Entry
SMWW4_v1c27170    CDS       T02448                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smw  Serratia marcescens WW4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMWW4_v1c27170 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMWW4_v1c27170 (adhE)
   00620 Pyruvate metabolism
    SMWW4_v1c27170 (adhE)
   00650 Butanoate metabolism
    SMWW4_v1c27170 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SMWW4_v1c27170 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMWW4_v1c27170 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMWW4_v1c27170 (adhE)
   00626 Naphthalene degradation
    SMWW4_v1c27170 (adhE)
Enzymes [BR:smw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMWW4_v1c27170 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SMWW4_v1c27170 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2949116..2951788
Genome map
AA seq 890 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDQPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DSGVICASEQSVIVVDAIYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQS
APKIAEMAGIKVPANTKVLIGEVKLVDESEPFAHEKLSPTLAMYRAKDFEDAVAKAEKLV
AMGGIGHTSCLYTDQDNQTARIAYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRFLFNNGYADQITKVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVLYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEYLPASYKEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLAWLDELKTELGIPTSIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGREFSETVEEEATAPAVAKAAVKKSKK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaactaaacgagcttgtcgcacgtgtcaaaaaagcccag
cgcgaatatgccaacttcactcaagagcaagtggataaaatcttccgcgctgccgccctc
gccgctgctgatgcccgtatcccgttggccaaaatggccgtggaagaatccggaatgggt
atcgtcgaagacaaagtgatcaaaaaccacttcgcttccgagtacatctacaacgcctat
aaagatgaaaaaacctgtggcatcctgtctgaagatgacactttcggtaccatcaccatc
gccgaacctatcggcctgatttgcggtatcgtccctaccaccaacccaacttctaccgcg
atcttcaaagcgctgatcagcctgaaaacccgtaacggcatcatcttctcgccgcacccg
cgtgcgaaaaatgccaccaataaagccgccgatatcgtgctgcaagccgctatcgccgcc
ggcgcgccaaaagacatcatcggttggatcgaccaacctaccgtcgaactgtccaaccaa
ctgatgcaccaccctgacatcaacctgatcctggccaccggtggcccgggcatggtgaaa
gccgcctacagctccggcaaaccggccatcggcgtcggcgccggtaatacgccggtcgtg
gtagacgaaaccgcagacatcaagcgcgtggtcgcctctatcctgatgtccaaaaccttc
gacagcggcgttatctgcgcttccgaacagtcggtcatcgtcgttgacgctatctatgat
gcggtacgcgaacgcttcgcttcccacggcggctatctgctgcagggtaaagaactgaaa
gcggtgcaggacatcatcctgaaaaacggcggtctgaatgcggccatcgtcgggcaatcc
gcaccgaaaatcgccgaaatggcaggcatcaaagtaccggccaacaccaaagtgctgatc
ggtgaagtgaagctggtcgacgagtccgaacctttcgcacatgaaaaactgtcgcctacc
ctggcgatgtaccgtgccaaagacttcgaagacgcggtcgccaaagccgaaaaactggtc
gccatgggcggtatcggccacacctcctgcctgtacaccgaccaggataaccaaacggct
cgcatcgcctacttcggcgataaaatgaaaacggctcgcatcctgatcaacaccccggct
tctcagggcggtatcggcgacctgtacaacttcaaactcgcgccttcgctgacgctgggt
tgcggttcctggggtggcaactccatctctgaaaacgtcggacctaaacacctgatcaac
aagaaaactgtagcgaagcgagcagaaaacatgttgtggcacaaacttccgaaatcgatc
tacttccgccgtggctcgctgcctatcgcgctggaagaagtggcgaccgacggggcgaaa
cgcgccttcatcgtgaccgaccgtttcctgttcaacaacggctatgctgaccagatcacc
aaggttctgaagtctcacggcatcgaaaccgaagtgttcttcgaagtggaagccgatccg
acgctgagcatcgtgcgtaaaggcgccgagcagatgaactccttcaaaccggacgtcatc
atcgcgctgggcggcggttcgccgatggacgccgcgaaaatcatgtgggtgctgtacgaa
catcctgaaacccacttcgaggatctggcgctgcgcttcatggacatccgcaagcgtatc
tacaaattcccgaaaatgggcgtgaaagcgaaaatgatcgccatcaccacaacctcaggt
accggttcagaagtcacgccgttcgcggtcgtgaccgacgacgccaccgggcagaaatac
ccgctggccgactatgcgctgaccccggacatggcgattgtcgacgccaacctggtgatg
aacatgccgaaatccctgtgcgccttcggtggcctggatgcggtgacccacgcgctggaa
gcctacgtctcggtgctggcgaacgaatactccgacggccaggcgctgcaggcgctgaaa
ctgttgaaagagtatctgccggccagctacaaagaaggcgcgaaaaacccggttgcccgt
gaacgcgtgcacaacgccgccaccatcgccggtatcgctttcgccaacgccttcctcggg
gtttgtcactccatggcacacaaactgggttcggagttccacattccgcacggcctggcc
aacgcgatgctgatttccaacgtcattcgctacaacgcgaacgacaacccgaccaagcag
acggccttcagccagtacgaccgccctcaggcgcgccgccgctacgctgaaatcgccgac
cacctcggcctgagcgcaccgggcgaccgcaccgcgcagaagattgagaaactgctggcc
tggctggacgagctgaaaaccgagctgggcatcccaacctccatccgtgaggcgggtgtg
caggaggcggacttcctggcgaaagtcgacaagctgtcggaagacgcgttcgacgaccaa
tgcaccggcgccaacccacgctatccgctgattgccgaactgaagcaaatcatgctggat
accttctacggccgcgaattcagcgaaacagtcgaagaggaagcgacagctccggctgta
gccaaagccgcggtaaagaagtccaagaaataa

DBGET integrated database retrieval system