KEGG   Serratia marcescens WW4: SMWW4_v1c40010Help
Entry
SMWW4_v1c40010    CDS       T02448                                 

Gene name
dsbC
Definition
protein disulfide isomerase II
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
smw  Serratia marcescens WW4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4331898..4332614)
Genome map
AA seq 238 aa AA seqDB search
MKKGLMLLSLLVASVAGAAHADDAAIKKALASLGIQQADVQPSPVNGLKTVLTDSGVLYA
SEDGKHILQGPLFDVSGKEPVNVTNQLLSSKMDALKDQMIVYKAPKEKHVITVFTDITCG
YCHKLHQQMKEYNDLGITVRYLAFPRQGLASQAEKDMQSIWCTADKAKAFDAAMKGDAVS
PATCKTDISKHYELGVQFGIQGTPAIILENGMMIPGYQGPKEMAAMLDAHQAATKAGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttaatgctgctttcactgctggtggcctcggtggccggcgccgcccat
gccgatgacgcggcgatcaaaaaagcgctcgccagcctgggcatccagcaggcggacgtg
cagccttcaccggtcaacggcctgaaaaccgtgctgaccgacagcggcgtgctgtacgcc
tccgaagacggcaagcacatcctgcagggcccgctgttcgacgtcagcggcaaagagccg
gtcaacgtgaccaaccaactgctgagcagcaagatggacgcgctgaaagatcagatgatc
gtgtacaaggcgccgaaagagaaacacgtgatcaccgtgttcaccgacatcacctgcggt
tactgtcacaagctgcatcagcagatgaaagagtacaacgatctgggtattaccgtgcgt
tacctggcattcccgcgccaggggctggcatcccaggctgaaaaagacatgcagtcgatc
tggtgcaccgccgacaaggccaaggcgttcgacgccgccatgaagggcgacgccgtttct
ccggcgacctgtaaaaccgacatcagcaagcattacgagctgggcgtacagttcggcatt
cagggcacgccggccatcatcctggaaaacggcatgatgatcccgggctatcaggggccg
aaagagatggccgccatgctggatgcgcaccaggccgccaccaaagccggtggttaa

DBGET integrated database retrieval system