KEGG   Serratia marcescens WW4: SMWW4_v1c41710Help
Entry
SMWW4_v1c41710    CDS       T02448                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
smw  Serratia marcescens WW4
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SMWW4_v1c41710
   00500 Starch and sucrose metabolism
    SMWW4_v1c41710
Enzymes [BR:smw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SMWW4_v1c41710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
4518785..4520197
Genome map
AA seq 470 aa AA seqDB search
MMEELSLIKQALRAVMNGQPLALRDPHRPDWHLAPSVGLLNDPNGFIQHNGVYHLFYQWN
PLGCDHRNKCWGHWQSADLLRWEHQPIALAPGACYDSHGCYSGSAVVAEGKITLIYTGNV
KFPDGSRTAYQCLAQESERGEYRKLGPVLPLPEGYSGHVRDPKVWRHQNDWYMVLGARDL
QDRGKVLLFRSSDLRDWQALGEIAGSGLNGLEEFGYMWECPDLFSLDGDEVLICCPQGLT
PQPERYLNRYQAGYLLGKLDYRQAAFSHGEFRELDAGFEFYAPQTTLAEDGRRLLFGWMG
VPEQDEEAHPTRRYGWIHTMTCPRELSLRHGRLHQRPARELQQLRGERAGWQGRADNAPA
YALGAAELQLTPQGPFNATFGDAMTLNWDGERLRLTRASLTDGRPEHRYWRGPVTHLQLL
FDRSSVEIFINHGEAVMSARYFPAGEPQLRLCGSAPLALEYWPLTPCMLE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagaactcagcttaatcaaacaggcactgcgggcggtaatgaacggccagccg
ctcgcgctgcgcgatccgcaccgaccggactggcatctggcacccagcgttggcctgctg
aacgatcccaacggctttatccagcataacggcgtttatcatctgttttatcagtggaat
ccgctgggttgcgatcatcgcaacaaatgctggggacactggcagtcggctgatttgctg
cgttgggagcaccagccaatcgccctggcgcccggcgcctgttacgacagccacggctgt
tactccggctcggcggtggtggcggaaggcaaaatcacgctgatctacaccggcaacgtg
aaattcccagacggctcacgcaccgcttaccaatgcctggctcaggaaagcgaacggggc
gaatatcgcaaactcgggccggtgctgccgctgccggagggctacagcggtcacgtacgc
gatccgaaagtgtggcgtcatcaaaatgactggtacatggtgctcggcgcgcgtgacctg
caggatcgcggcaaggtgctgctgtttcgttccagcgatctgcgcgactggcaagcgctg
ggagagatcgccggttccggactgaacggcttagaggaattcggctacatgtgggagtgc
ccggacctgttctcgttggacggcgacgaggtgttgatctgctgtccgcaggggctgacg
ccgcagccggaacgctatctcaaccgttatcaggccggttatctgctcggcaagctggat
taccggcaggcggccttcagccacggcgaattccgcgagctggacgccggcttcgagttc
tacgcgccgcagacgacgttggcggaagatggccgccgcctgctgttcggctggatgggc
gtgcccgagcaagatgaagaagcccatccgacgcgccgttacggctggatccacaccatg
acctgcccgcgcgaactgtcgctgcggcatggccgcctccaccagcgcccggcgcgcgag
ctgcaacagctgcgcggtgagcgagcaggctggcaaggccgcgccgataacgcccccgcc
tatgcgctgggggccgcggagctgcaattgacgccgcagggcccgttcaacgcaaccttt
ggcgacgcgatgacgctgaactgggacggcgaaaggctgcggctgacacgtgcttccctg
accgacggccggccggagcaccgttactggcgcggcccggtcacgcatctgcaactgctg
ttcgatcgttccagcgtggagattttcatcaaccacggcgaggcggtgatgagcgcacgc
tacttcccggcgggtgagccgcaactgcggctgtgcgggagcgcgccgctggcgttggaa
tactggccgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system