KEGG   Serratia marcescens WW4: SMWW4_v1c45870Help
Entry
SMWW4_v1c45870    CDS       T02448                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (amylomaltase)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smw  Serratia marcescens WW4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4952796..4954886)
Genome map
AA seq 696 aa AA seqDB search
MDRKRIDQAAAQAGIAADFINAHGKRQAIEPETKRKLLAAMNRADGAQEGAASPLPAVKV
FYQGAPLALTPAGEGEYLWALQREDGECLQGRVGARKTLTLPGDLPMGYHQLTLSQGEQQ
WSCRVIVAPRRCFEPDALLTGKKLWGACVQLYTLRSDRNWGIGDFGDLRLMVEQVGERGG
AFVGLNPIHALYPANPESASPYSPSSRRWLNLAYIDVNAVEDFQRSDAAQRWWQKPATQK
QLAKARAAEWVDYTAVMQLKLAALKLAFPLFQARQLNDAQRLAFEQFVAEGGDSLYQQAA
FDALHAHLAAKDASQWGWPAWPERYRQGQSDAVRQFCAEHQDAVRFYLWLQWLAATQFAQ
CFDQSRQQQMPIGLYRDLAVGVAEGGAETWCDRELYCLRASVGAPPDILGPLGQNWGLPP
MDPHVMAARGYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGETADRGAYVKYPVDD
LLAVLALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFESDGEHHFRAPQAYP
VQAMATITTHDLPTLRGYWQSDDLTLGNRLGLYPDAEILQALFADRERAKQGLLDGLHRY
GCVPQKVGKKAALLGMSPLLNRGLQRYVADSASALLGLQPEDWLDMADPVNIPGTSDQYP
NWRRKLTQTLEEMFADPHINRLLKDLDKRRRKVSVG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcaagcgtatcgatcaggcggcagcgcaggcggggatcgctgccgattttatc
aatgcccacggcaagcggcaggcgattgaaccggagaccaagcgcaagctgttggcggcc
atgaatcgggccgatggcgcgcaggaaggcgcggcatcaccgttaccggcggtcaaggtg
ttctatcagggcgcgccgctggcgttgaccccggcgggtgaaggcgagtacctgtgggcg
ctgcagcgtgaagacggcgaatgcctgcaggggcgcgtcggcgcgcgcaagaccctgacg
ctgcccggcgatctgccgatggggtaccaccaattgacgctgagccagggcgagcagcag
tggtcatgccgagtgatcgtcgcgccgagacgctgcttcgagccggacgccttgctgacc
ggcaagaagctgtggggggcctgcgttcagctgtatacgctgcgttccgatcgcaactgg
ggcatcggcgatttcggcgatctgcgcctgatggtggagcaggtgggggaacgcggcggt
gccttcgtcggcctcaatccgatccatgcgctgtatccggccaacccggagagcgccagc
ccctacagcccctcgtcgcgccgctggctgaatctggcgtatatcgacgtcaatgcggtg
gaggatttccagcgcagcgacgcggcgcagcgctggtggcagaagccggcgacgcagaag
cagctggccaaggcgcgcgccgcggagtgggtggactacaccgccgtgatgcagctgaag
ctggcggcgctgaagctggcgttcccgctgtttcaggcgcgccagctgaacgacgcgcag
cgtctggcgttcgagcagttcgtggctgaggggggcgacagcctgtatcagcaggcggcg
tttgatgcgctgcatgcccatctggcggccaaagacgccagccagtggggctggccggcc
tggcccgagcgctatcggcaggggcagagcgatgcggtgcggcagttctgcgccgaacat
caggacgcggtccgcttttacctgtggctgcaatggctggcggccacgcagttcgcacag
tgttttgaccagagcaggcagcagcagatgccgattggcctgtatcgcgatctggcggtc
ggggtggcggaaggcggggcggaaacctggtgtgaccgtgagctgtactgcctgagagcg
tcggtcggggcaccgccggatattctggggccgctggggcaaaactggggcctgccgccg
atggatccgcacgtgatggcagcgcgcgggtatcagccgttcatcgatcttttgcgcgcc
aacatgaccagctgcggcgcgctgcgcatcgatcacgtcatggcgctgctgcggctgtgg
tggatcccgtatggcgaaaccgccgatcgcggcgcctatgtcaaatacccggtggacgat
ctgctggcggtgctggcgctggaaagccagcgccaccgttgcatggtgatcggcgaggat
ctcggcacggtgccggtggagatcgtcggcaagctgcgcgacagcggcgtctactcctac
aaagtgctctatttcgaaagcgacggcgagcaccatttccgcgcgccgcaggcctatccg
gtgcaggcgatggcgaccatcaccacccacgatctgccgacgctgcgcggctattggcaa
agcgacgatctgacgctcggcaatcggctgggcctttacccggatgcggagatcctgcag
gcgctgttcgccgatcgggaacgcgccaaacaggggttgctggacggattgcatcgctat
ggctgcgtgccgcagaaggtgggcaagaaggcggcgctgctcggcatgagcccgctgctc
aaccgcggcctgcagcgctatgtcgccgacagcgccagcgctctgctcggcctgcagccg
gaagactggctggatatggcggatccggtcaacattcccggcaccagcgatcagtaccct
aactggcggcgcaagctgacccagacgctggaggagatgtttgccgacccgcacataaac
cgcttactgaaggatttggacaagcggcgccgcaaggtgtcggtgggctga

DBGET integrated database retrieval system