KEGG   Serratia marcescens WW4: SMWW4_v1c45980Help
Entry
SMWW4_v1c45980    CDS       T02448                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smw  Serratia marcescens WW4
Pathway
smw00500  Starch and sucrose metabolism
smw01100  Metabolic pathways
smw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMWW4_v1c45980 (glgB)
Enzymes [BR:smw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SMWW4_v1c45980 (glgB)
Exosome [BR:smw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMWW4_v1c45980 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AGE20385
Position
complement(4971945..4974131)
Genome map
AA seq 728 aa AA seqDB search
MPVLPDRDVIDQIIAGHYADPFALLGMHATDNGLQVRALLPDAGAVWLVEQQTGRRLVQL
NCDDPRGFFSAVVPRRKNPFRYQLQVSWRDHQQIVDDPYRFGPLLQDIDSWLLAEGTHLR
PYERLGAHLVTLDGIDGVSFAVWAPNAQRVSVVGEFNFWDGRRHPMRLRRENGIWELFLP
GVQAGQLYKYEIVDCYGNTQLKADPDAFEAQMRPDTASLVAPLPEVVPSTPARRRANDFD
QPIAIYEVHLGSWRRHTDNHFWLSYGELAVQLIDYVKGMGFTHIELLPINEHPFDGSWGY
QPLGLYAPTRRFGTPADFRAFVAAAHEAGINVILDWVPGHFPSDAYGLANFDGTALYEYA
DPREGYHQDWNTLIYNYGRHEVRNYLAGNALYWLERFGIDALRVDAVASMIYRDYSRADG
EWVPNYYGGNENLEAIAFLRYTNQTIGQAQPGAVTLAEESTDYPGVTLPPDANGLGFHYK
WNLGWMHDTLNYMKCDPVHRKYHHNQMTFGMLYAYTENFVLPISHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGCEFAQGREWNFDTSLDWHLLEGLDNWHNGVQ
RLVRDLNHCYRQQAPLYERDYFPDGFEWLVVDDHDNSVFAFARYDSQGNELIAISNFTPV
PRYRYRIGISRAGDYREILNTDSHHYHGSNAGNQGRVSSEMVGSHGRDFSISVTLPPLST
IYLLREAP
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtacttcccgatcgtgacgtgattgatcagatcatcgccggccattacgccgat
cccttcgctctgcttggcatgcatgcgaccgataacggtctgcaggtgcgcgcgctgctg
ccggacgccggcgcagtctggctggtggaacagcaaaccggccggcggctggtgcagctg
aactgcgacgatccgcgcggtttcttcagcgcggtggtgccgcggcgcaaaaatcctttc
cgctatcagctgcaggtcagctggcgcgatcatcaacagatcgtcgacgatccttatcga
ttcggcccgctgctgcaggatatcgacagttggctattggctgagggtacgcatttgcgc
ccctatgaacggctgggcgcccacctcgtcacgctggatggaatcgacggcgtcagcttt
gcggtctgggcgcccaacgcccagcgtgtttcggtggtgggggaattcaacttctgggac
ggccgccgccacccgatgcgtctgcggcgtgaaaacggcatctgggagctgttcttgccc
ggcgtgcaggccggccagctgtacaaatatgaaatcgtcgattgctacggcaatactcag
ttgaaagccgatcctgacgccttcgaggcgcagatgcgcccggataccgcctcgctggtg
gcgccgctgccggaggtggtgccgtcgacgccggcgcgccgccgcgccaacgattttgac
cagccgatcgccatctacgaggtgcatctcggctcatggcgccgccacactgacaaccac
ttctggctcagctacggcgagctggcagtgcaactgatcgattatgtgaagggcatggga
ttcacccatatcgagctgctgccgatcaacgagcacccgttcgacggcagctggggctat
cagccgctggggctgtatgcgccgacccggcgcttcggcacgccggccgacttcagggcg
tttgtggcggcggcgcatgaggcgggcatcaacgtgatcctcgactgggtgccggggcac
ttcccgagcgacgcctacggcctggcgaatttcgacggcactgcgctgtacgagtacgcc
gatccgcgcgagggctaccatcaggactggaataccctgatctacaactacggtcgtcac
gaggtacgcaactacctggcgggcaacgcgctgtattggctggagcgtttcggcatcgac
gcgctgcgggtcgatgcggtggcgtcgatgatctatcgcgattacagccgcgccgacggc
gaatgggtgccgaattactacggcggcaacgagaatctggaggccatcgccttcctgcgt
tataccaaccagactatcggccaggcgcagccgggcgcggtgacgctggcggaggagtcc
accgactatcccggcgtcaccctgccgccggacgccaacggcctggggttccattacaaa
tggaacctcggctggatgcacgacacgctcaattatatgaagtgcgatccggtgcaccgc
aagtatcaccacaaccagatgaccttcggcatgctgtacgcctataccgagaacttcgtg
ttgcctatctcgcacgatgaagtggtgcacggtaaaaaatcgatcctcgaccgcatgccg
ggcgacgcctggcagaagttcgccaacctgcgcgcctattacggttttatgtgggcgcat
ccgggcaaaaagctgctgtttatgggctgcgaatttgcgcaggggcgcgagtggaatttc
gataccagcctcgactggcatttattggaagggctggataactggcataacggcgtgcag
cggctggtgcgcgatctgaaccactgctaccggcagcaggcgccgctgtacgagcgcgac
tacttcccggatggcttcgagtggctggtggtcgacgatcacgataactcggtgttcgcc
ttcgcgcgctacgattcgcagggcaatgagctgatcgccatcagcaattttaccccggtg
ccgcgctaccgctaccgcatcggcatttcccgcgccggtgactatcgcgagatcctcaat
accgattcgcaccactatcacggcagcaacgccggcaatcaggggcgggtctcttccgaa
atggtcggcagccatggccgcgatttctctatcagcgtgacgttgccgccattgtcgacc
atttatctgctgcgggaggcgccatga

DBGET integrated database retrieval system