KEGG   Sinorhizobium meliloti SM11: SM11_chr0051Help
Entry
SM11_chr0051      CDS       T01885                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SM11_chr0051 (rbsK)
Enzymes [BR:smx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SM11_chr0051 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(53876..54775)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLIATTARLPKPGETVAGTDFSTAAGGKGANQALAARRAGASVRMAGAVG
SDAFAEGALALLKEAGTDLDLTKTVGEPTGTAHIIVGGDGENVIVVVASANARVSGDDAA
NVVAQMSAGDTLMLQLEIPSASVEKALSEAKRRGIRSIINIAPLTPDAARLGRMADIVIA
NETEFELLAGKAGIAGAEREEAMNGLHAETRQTVIVTLGAEGVVAIHEGELHRAKGLTIE
PVDTVGAGDTFCGYLAAGLDAGLAFSEALRRAAIAGSLACLKPGAQPSIPLAAEVAARL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtttttgggtccatcaacatggacctgattgccaccaccgcacgccttccg
aagcccggcgaaacggttgccggaacggacttttccactgcggcgggcggcaagggcgca
aaccaggcgctcgcggcgcgccgcgccggcgcctcggtgcgcatggcaggtgccgttggc
tccgacgcctttgccgagggcgcgctggcgctgctcaaggaggccggcaccgatctcgat
ctgacgaagaccgtcggcgagccgaccggaacggcgcacatcatcgtcggcggcgacggc
gaaaacgtcatcgtcgtggtcgccagcgccaatgcacgcgtaagcggggacgacgccgcg
aacgtggttgcgcagatgtcggccggcgacacgctgatgctgcagctcgaaattccctcc
gcctcggtggaaaaggcactctccgaagcaaaacggcggggcatccgatcgatcatcaac
atcgcgccgctgacgccggatgcggcgcgcctcggccgcatggccgatatcgtcattgcc
aacgagaccgagttcgagctgctcgccggcaaagcgggcatcgccggcgccgagcgggaa
gaggctatgaacgggcttcacgccgagacccgccagaccgtgatcgtaacccttggtgct
gagggcgtggtggcgattcacgaaggcgaactccaccgcgcgaaagggctcacgatcgag
cccgtcgatacggtcggtgccggagatacgttctgcggctatctcgccgccggcctcgac
gccggtctcgcattctccgaggcgctccgccgcgccgcgattgcgggatcgctcgcctgc
ctcaagcccggcgcgcagccctcgataccgcttgccgccgaggtcgccgcccggctctag

DBGET integrated database retrieval system