KEGG   Sinorhizobium meliloti SM11: SM11_chr0057Help
Entry
SM11_chr0057      CDS       T01885                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smx01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:smx00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59259..60452)
Genome map
AA seq 397 aa AA seqDB search
MFPTDPVSNLAALIRCPSVTPAEGGALAALEAMLAPVGFKVDRVVAKEPGTPDIENLYAR
TGGEGPHLMFAGHTDVVPVGDEAAWSRPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVAR
HIEKHGAPKGSISFLITGDEEGPAINGTVKLLEWAAARGERWDACLVGEPTNPDCIGDMI
KIGRRGSLSGRITVHGVQGHAAYPHLADNPVRSILQIAQALMDPPFDDGTENFQPSNLEV
TTIDVGNTAVNVIPAKASAAFNIRFNDRWTAESLMAEIVARLDRAAAGSALRPGRAPARY
EIVWNERPSHVFLTRNNALIDSLSGAVEAVTGRQPQLSTTGGTSDARFIKDYCPVVEFGL
VGKTMHMVDERVALADLETLTGIYETFIARWFGHAAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgaccgatcccgtctccaatctcgctgccctcattcgctgcccctccgtcaca
cccgccgagggaggcgcgctcgcggctcttgaagccatgcttgctccggtcggcttcaag
gtcgaccgggtcgtggcgaaggaacccggaacgcccgacatcgagaacctttacgcccgg
accgggggcgaaggaccgcatctgatgttcgcaggccacaccgatgtggtgccggtcggc
gacgaggcggcctggagccgaccgcccttctccgccgcgatcgccgaaggcgaaatgtac
ggacgcggcgccgtcgacatgaagggcggcatcgcctgtttcgtggcggcagtcgcccgt
cacatcgagaagcatggcgcgcccaagggctcgatctccttcctcatcaccggcgacgag
gaaggcccggcgatcaacggcacggtgaagctcctcgaatgggcggcggcaaggggcgag
cgctgggacgcctgtctcgtcggcgagccgaccaatccggactgcatcggcgacatgatc
aagatcggccggcgcgggtcgctctccggccggatcaccgttcatggcgtccagggccac
gccgcctatccgcatcttgcggacaatccggtgcgcagcatcctgcagatcgcacaggcc
ctgatggacccgcccttcgacgatggcaccgaaaatttccagccttcgaacctcgaggtc
acgaccatcgatgtcggcaataccgcagtaaacgtcattcccgccaaggcgagcgccgcc
ttcaacatccgtttcaacgaccgctggacggccgaaagcctgatggcggagatcgtggcg
cgtctcgaccgcgcagcagccggtagcgcgctgaggcccggccgggctccggccagatac
gagatcgtctggaacgagcgtccgagccacgtcttcctgacgcgcaacaacgcgctcatc
gattcgctttcgggtgccgtggaggccgtcaccgggcggcagccgcagctgtcgaccacc
ggcggtacatcggacgcgcgtttcatcaaggactattgcccggtcgtcgaattcggcctc
gtcggcaagaccatgcacatggtcgacgaacgcgtcgcccttgccgatctcgaaaccctg
accgggatatacgaaaccttcatcgcccgctggttcggtcatgccgctgcttga

DBGET integrated database retrieval system