KEGG   Sinorhizobium meliloti SM11: SM11_chr0159Help
Entry
SM11_chr0159      CDS       T01885                                 

Gene name
fadB
Definition
putative fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SM11_chr0159 (fadB)
   01212 Fatty acid metabolism
    SM11_chr0159 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SM11_chr0159 (fadB)
   00650 Butanoate metabolism
    SM11_chr0159 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SM11_chr0159 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SM11_chr0159 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SM11_chr0159 (fadB)
   00310 Lysine degradation
    SM11_chr0159 (fadB)
   00380 Tryptophan metabolism
    SM11_chr0159 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM11_chr0159 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SM11_chr0159 (fadB)
   00281 Geraniol degradation
    SM11_chr0159 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SM11_chr0159 (fadB)
Enzymes [BR:smx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SM11_chr0159 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SM11_chr0159 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SM11_chr0159 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(167948..170161)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPDKSMNVFTEEVMKELDAIIDQTTADPAVKGVVITSGK
SSFSGGADLSMIKSMFTFQAEERKKDPDNAARKLFDLVGRMTGLFRKLETSGKPWVSAIN
GTCMGGAFEMSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTPARAKAMGLVHEVVDPDKLIEAAKAMIKNGLKPVQPWDEKGFKLPGGGIWTPAS
AQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTALKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKTELKKVGVVGAGFMGASIAYVTAAGGIPVTLIDRDME
AAEKGKTHSEGLVKDAIGKGRLTKEEGEALLSRITPSADYGDLRDAGLVIEAVFEDRQVK
KDVIEKVEAVIAEDAIFASNTSTLPITGLARNSKRPDRFIGIHFFSPVEKMMLTEVILGK
ETGDRALAAALDYVAAIRKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKAAVADLGDKAVDPRHMALIDKMVDELDRRGRKNG
KGFYEYPAKPARKYLWPGLKELYPQKDAGEIEVGVLKQRLLVTIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGAKAFVELCEKLAADHGDHFRPTPLLKEMAEKG
ETFYGRFDPYGAGQKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacgaacttcaagatcgaaaccgacgccgacggcattgcgctggtcacctgg
gacatgcccgacaagtcgatgaacgtcttcaccgaagaggtgatgaaggaactcgacgcc
attatcgatcagacgaccgcagatcctgccgtcaagggcgtggtcatcacctccggcaaa
tcctccttctccgggggtgccgacctttcgatgatcaagtcgatgttcaccttccaggcc
gaggaaaggaagaaggacccggacaacgcggcccggaaactcttcgacctcgtgggccgg
atgacgggtctcttccgcaagctcgaaacctcgggcaagccctgggtgtcggccatcaac
ggcacctgcatgggcggcgccttcgagatgtcgctcgcctgccacggccgtgtcgcctcc
aatgcgaaatcggtgaagatcgcgcttcccgaggtcaaggtcggcattttcccgggcgcc
ggcggcacccagcgcgttccgcggctgaccaatacgcaggacgcgctgcagatgatgacg
accggctcctcgctcacgccggcgcgggcaaaggccatggggctcgtccacgaggtggtc
gatccggacaagctgatcgaggctgccaaggcgatgatcaagaacggcctgaagccggtt
cagccctgggacgagaagggcttcaagctgccgggcggcggcatctggacgcccgcctcc
gcgcagctctggccggccgcctccggcatcctgcgccgcgagacctacggcaattacccc
ggcgcgatcgcgatcctgaaatgcgtctatgaggggctgcaggttcccttcgatacggct
ttgaagatcgagcagcgctatttcaccgaaatcctgcagacgaccgaagccttctcgatg
atccggtcgctgttcgtctcgatgcaggaactcggtaagggcgcgcgccggccggccggt
gtaccgaagaccgagctcaagaaagtcggcgtcgtcggcgccggtttcatgggcgcctcg
atcgcctatgtaaccgcggcgggcggcatccccgtcaccctcatcgaccgcgacatggaa
gctgccgaaaagggcaagacgcattcggaaggcctggtcaaggacgcgatcggtaaggga
cgcttgaccaaggaggaaggcgaagcgctgctttcgcgcatcacaccttcggcggactat
ggcgatctcagggatgccggcctcgtcatcgaggcggtcttcgaggaccggcaggtcaag
aaggacgtgatcgagaaggtcgaagcggtgatcgccgaggacgcgatcttcgcctccaac
acctcgacgctgccgatcaccggcctcgccaggaattccaaacgcccggaccggttcatc
ggcattcatttcttctcgccggtcgagaaaatgatgctgaccgaggtgatcctcggcaag
gagaccggagaccgtgcgctcgcggccgcgctcgactatgtcgcggcgatcaggaagacg
ccgatcgtcgtcaacgacacgcgcggcttctacgtcaatcgctgcgtcttccgctatatc
cacgaagcctatgacatgctgatcgagggcgtaccgccggcgatgatcgagaacgccgcc
aagatggccggcatgccggtcggaccgctgtcgctcaacgacgaggtggcgatcgacctc
agccagaagatcctgaaggcggccgttgccgatctcggcgacaaggccgtcgatcccagg
cacatggcgctgatcgacaagatggtcgacgagctcgaccggcgcggccgcaagaacggc
aagggtttctacgagtatccggcaaagccggccaggaaatatctctggccgggcctgaag
gagctctacccgcagaaggatgccggcgagatcgaggtcggtgtgctcaagcagcgcctg
ctcgtgacgatcgcactcgaagccgcgcgtacgatcgaggagggcatcgtcaccgacccg
cgcgaagccgatgtcggctcgatcctcggcttcggctttgcgccctacaccggcggcacg
ctctcctacatcgacggcatgggtgcgaaagccttcgtcgagctttgcgaaaagctcgcc
gcggaccatggcgaccacttccggccgacgccgcttttgaaggagatggcggaaaagggc
gaaaccttctacgggcgcttcgacccgtatggcgcggggcagaaggcggcataa

DBGET integrated database retrieval system