KEGG   Sinorhizobium meliloti SM11: SM11_chr0186Help
Entry
SM11_chr0186      CDS       T01885                                 

Gene name
hipO2
Definition
putative hippurate hydrolase protein
Orthology
K01451  
hippurate hydrolase [EC:3.5.1.32]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SM11_chr0186 (hipO2)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     SM11_chr0186 (hipO2)
Peptidases [BR:smx01002]
 Metallo Peptidases
  Family M20
   SM11_chr0186 (hipO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(201356..202525)
Genome map
AA seq 389 aa AA seqDB search
MKLSAAIDNAMPELVAIRRDLHAHPELGLEETRTSAFIARHLEELGYEVATGIAKTGVVG
TLRNGTGSRSIGIRADIDALPIQEETGVAYASTKPGLMHACGHDGHTAMLLGAARALAER
RNFDGTIHLIFQPAEENAGGAKIMVDEGLFDRFPCDAVFALHNEPNLPFGQFALREGPIM
AAVDEARITVHGRGGHGAEPQATADPIVCGASIVMALQTIVARNIHPMDPSVVTVGAFHA
GSASNIIPERAEIVVGIRSFDPAVRDELERRIRMIAEAQASSFGMRATVDYERSYDATIN
HKAETDFLREAAIRFAGADKVVDLARPLMGSEDFAYMLKERPGSYFFLGSRVTGEEKSLH
HPGYDFNDDLLPIGAAFWTELAEAYLARR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttccgccgccatcgacaatgccatgccggaactcgtcgccatccggcgcgat
ctgcatgcccatcctgagcttgggctcgaagaaacgcggacatccgccttcatcgcccgc
cacctcgaagagctcggctatgaggtggcgacgggcatcgcgaaaacgggcgtggtcggc
acgctaaggaatggcaccgggtcgcgctcgatcggcatccgcgccgatatcgatgcgctg
ccgatccaggaggaaaccggggtcgcctatgcaagcacgaagccgggcctgatgcatgcc
tgcggtcatgacggccacacggcgatgctgctcggcgccgcccgcgcgcttgccgagcga
aggaatttcgacggcacgattcacctcatctttcagccggcggaggagaatgccggtggc
gcgaagatcatggtcgacgagggtctcttcgacagatttccctgcgacgccgtgttcgcg
ctccacaacgaaccgaacctgcccttcggccagttcgctctgcgcgaaggcccgatcatg
gcggcggtcgacgaggcacggatcaccgttcacggccgcggcggccacggcgccgagccg
caggcgacggccgatccgatcgtctgcggcgccagcatcgtcatggcgctgcagaccatc
gtcgcacgcaacatccacccgatggacccctccgtcgtgaccgtcggcgcatttcacgcg
ggctcggcgagcaacatcatcccggagcgcgcggagatcgtcgtcggcatacgttccttc
gatcccgcggtccgcgacgagctcgaacgccgcatccggatgatcgccgaggctcaagcg
tcaagcttcggcatgcgggcaaccgtcgattacgagcggagctacgacgccacgatcaac
cacaaggcggagacggatttcctccgagaggccgccatccgcttcgccggcgccgacaag
gtcgtcgatctcgcccggccgctcatgggaagcgaggacttcgcctatatgctcaaggaa
aggcccggcagctatttcttcctcggctcgcgggtgacgggcgaggagaaatcgctccac
caccccggctatgatttcaacgacgatctgctgccgatcggcgctgccttctggaccgaa
ctcgccgaagcctacctcgcgcgccggtga

DBGET integrated database retrieval system