KEGG   Sinorhizobium meliloti SM11: SM11_chr0205Help
Entry
SM11_chr0205      CDS       T01885                                 

Gene name
pncA
Definition
probabable pyrazinamidase/nicotinamidase protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:smx00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230029..230664
Genome map
AA seq 211 aa AA seqDB search
MADAARPDLREAMADEALIVIDMQNDFCPGGALAVEGGDEIVPAVNRLIDASPHVVLTQD
WHPAGHSSFASTHPGKAPFQTVAMPYGEQTLWPEHCVQGSAGADFHPSLRWTSAELVIRK
GFRREIDSYSAFFENDHRTPTGLAGYLRERGIKSVTLCGLATDFCVAFSALDAVAKGFST
SVVLGACRGIDLNGSLAAMTLRMRDAGVRLI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgcggctcggccggatttgcgagaggcaatggctgacgaagccctgatcgtt
atcgatatgcagaacgacttctgccccggcggcgctctcgcggtcgagggcggcgatgaa
atcgtgcccgccgtcaatcgcctcatcgacgcgtcgccgcatgtcgtcctgacgcaggac
tggcacccggccggccattccagtttcgcctcgacgcatccgggcaaggctccgtttcag
accgtggcgatgccttacggagagcagacgctctggcccgagcattgcgtccaggggagc
gccggtgccgattttcatccgtccctgcgatggacctcggcggagctcgtcatacgcaag
ggcttccgtcgcgagatcgacagttattccgcctttttcgaaaacgaccaccggaccccg
accgggcttgccggttacctgcgcgagcgcggcataaaaagcgtgacgctttgcggcctg
gctaccgatttctgcgttgccttctcggcactcgatgcggtcgccaagggtttttcgacg
tcggtggtgctcggcgcctgccgtggcatcgatctgaacggctcgcttgcggccatgacc
ctgcgcatgcgcgatgccggcgtccggctgatctag

DBGET integrated database retrieval system