KEGG   Sinorhizobium meliloti SM11: SM11_chr0220Help
Entry
SM11_chr0220      CDS       T01885                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smx01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:smx00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
241349..242653
Genome map
AA seq 434 aa AA seqDB search
MAIRLNYLDTSFERDFAAFLTTKREGSEDVNAVVRAIIDDVRARGDAALADYSARFDGVD
FTVTGMAVTSAEIDAAIHAVAPEVLGALKVAATRIEAHHRRQLPKDDIYEDQMGVGLGSR
WTPIDAVGLYVPGGTASYPSSVLMNALPAKVAGVPRIVMVVPASGGAINPAVLAAARLAG
VEEIYRIGGAQAVAALAYGTETIESVAKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
VIADRDNDPDWIAADLLAQAEHDAGAQAILITDDAAFGDAVEKAVERQLTTLPRAETAAA
SWRDFGAVILVPDFDKAVPLANRIAPEHLELATADPDAMVPAIRNAGAIFIGGHTPEVIG
DYVGGSNHVLPTARSARFSSGLGVLDYVKRTSILRLGPDQLRILGPAAIALARSEGLEAH
ARSVAIRLNLGEEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatcaggctgaactatctcgatacgagctttgagcgcgatttcgccgcgttcctg
acgaccaaacgggaaggctccgaagacgtcaacgccgtcgtgcgcgccatcatcgacgat
gtccgcgcccgcggagatgcggcgctcgccgactattccgcgcgtttcgacggggtcgac
tttactgtaaccggcatggcggtgacgtcggcggaaatagacgcggcgatccacgcggtc
gctccggaagtactcggcgcattgaaggtcgcggcgacccgcatcgaggcgcatcaccgg
cggcaattgccgaaggacgacatttacgaagaccagatgggcgtcggcctgggctcgcgc
tggacgccgatcgacgcagtcggtctctatgtgccgggcggcacggcgagctatccgagc
tcggttctgatgaacgccctgccggccaaggtcgcaggcgtgccgcgcatcgtcatggtt
gtgccggccagcggcggggctatcaatccggcggtgctcgcggctgcccgccttgccggc
gtcgaggagatctaccgcatcggcggcgcgcaggccgtggcggcgctcgcttacggcacc
gagacgatcgagtcggtggcgaagatcgtcggccctggaaatgcctatgtcgcggccgcc
aagcggcaggttttcggcaccgtcggcatcgacatgatcgccgggccgtcggaagtgctg
gtgatcgcggaccgcgacaacgatccggattggatcgccgcggacctgctcgcccaggcc
gagcacgacgccggcgcgcaggcaatcctgatcaccgacgatgccgccttcggcgacgcg
gtcgaaaaggcggtggagcgccagctgacgacgctgccgcgcgccgagacggcggcagcg
agctggcgcgatttcggcgccgtgatcctggttccggatttcgacaaggccgtgccgctc
gccaaccgcatcgccccggaacatctcgagctggcgaccgccgatccggacgcgatggtc
cccgcgatccgcaatgccggcgcgatcttcatcggcgggcacacacccgaagtcatcggc
gattatgtgggcggttccaaccacgtgctgccgacggcgcgttcggcgcggttctcctcg
ggcctcggcgtgctcgactacgtgaagcgaacctcgatcctgcggctcggtccggatcag
ttgcgcattctcgggcctgccgcgatcgcgctggcgagatcggaaggcctcgaggcccat
gcccggtcggtcgccatccgtctcaatctcggggaagagggatga

DBGET integrated database retrieval system