KEGG   Sinorhizobium meliloti SM11: SM11_chr0278Help
Entry
SM11_chr0278      CDS       T01885                                 

Gene name
cheB1
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:smx02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:smx02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291585..292634
Genome map
AA seq 349 aa AA seqDB search
MSAPARVLVVDDSATMRGLISAVLNADPDISVVGQAADALEARQAIKQLDPDVVTLDIEM
PNMNGLEFLDKIMRLRPMPVIMVSTLTHRGAEATIAALEIGAFDCVGKPQPGDPHPFRDL
ADKVKAAARSQRKSMITSNRAAAPAATAVSDYRAGRKIVAIGASTGGVEALITVLQKFPA
NCPPTVITQHMPHTFTKSFAERLNRLCAPTVQEATDGARLEVGRVYLAPGGERHLEVHNA
AAPCCRLVDHPPVNGHRPSVDVLFDSVAELAGRNAIGVILTGMGRDGAAGLLKLRHAGAR
TFGQNEKTCVVYGMPRVAYELGAVETQLPLGSIGEEILKTAAARKEGIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccgcacgtgttctcgtcgtcgacgactcggccaccatgcgcggcctcatc
tccgccgtgctcaatgccgaccctgatatctccgtcgtcggacaggctgccgacgcgctc
gaggcgcgtcaggcgatcaagcagctcgaccccgatgtcgtgaccctcgacatcgagatg
ccgaacatgaacggcctcgaattcctcgacaagatcatgcggctgaggcccatgccggtg
atcatggtctcgacgctgacccataggggcgccgaagcgacgatcgccgcgctcgagatc
ggcgccttcgactgcgtcggcaagccccagccgggggatccgcatccgttccgcgatctc
gccgacaaggtcaaggcggccgcgcgttcgcagcgcaagtccatgatcaccagcaacagg
gcggccgcgccggcggcgacagccgtttccgactaccgggcagggcgcaagatcgtcgcg
atcggagcctcgaccggcggggtcgaggcgctgatcacggtcttgcagaagttcccggcg
aattgcccgccgacggtgatcacgcagcacatgccgcacaccttcaccaagagcttcgcc
gaacggctgaaccggctttgcgccccgacggtccaggaggcgacggatggcgcgcggctc
gaggtcggcagggtctatctggcgcccggcggcgaacgccatcttgaggtccataatgcc
gcagcaccctgctgccgactggtggatcatccgccggtcaacggacatcgtccctcggtc
gacgtgctgttcgattccgtcgccgaactggcgggccggaacgccatcggggtgattctc
accggaatgggccgcgatggcgccgccggtctcctgaaattgcggcatgccggagcacgc
accttcggtcagaacgaaaagacctgtgtcgtctacggcatgccgcgcgtcgcctatgaa
ttgggcgcggtcgaaacgcagctccccctcggatcgatcggggaggagattttgaagacg
gcggcagcccgaaaagaaggaatcgaataa

DBGET integrated database retrieval system