KEGG   Sinorhizobium meliloti SM11: SM11_chr1026Help
Entry
SM11_chr1026      CDS       T01885                                 

Gene name
fucA1
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smx00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057780..1058448
Genome map
AA seq 222 aa AA seqDB search
MNELQLRQSIIDHCRHMNAIGLNQGTSGNISLRHGGTMLITPSAIPYAEMTPDMIVAMPI
EGEYGAWVGPKKPSVEWPFHLDILRARPDVGAVVHTHASFSTILAMARKPIPACHYMIAA
FGGSDVRVADYARYGTKALSENVLKAMEGRSACLMANHGMIATGSSLEKAMWAAVELETI
AKQYYHVLLIGGPVVLPQEEIAGVIEGFATYGHQDKPKGEAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacttcaactgcgccagtcgatcatcgaccattgccgccacatgaatgcgatc
ggcctcaaccagggcacttcgggcaatatcagcctgcgccacggcggcacgatgctgatc
accccgtctgcgatcccctatgccgagatgacgccggacatgatcgtcgccatgccgatc
gagggcgagtatggcgcctgggtagggccgaagaagccctcggtcgaatggcccttccac
ctcgacattctgcgggcgcggccggatgtcggcgccgtcgttcatacccacgcgagcttc
tcgacgatcctcgcgatggcgcgcaagccgattcccgcctgtcactacatgatcgccgcc
ttcggcggttccgacgtgcgcgtcgccgattacgcccgctacggcacgaaggcgctgtcg
gaaaacgtgctgaaggcgatggaggggcgttccgcctgcctcatggccaatcacggcatg
atcgcgaccggttcgagcctggaaaaggcgatgtgggcggcggtcgagctcgagacgatc
gccaagcaatattaccacgtgctcctgatcggcggtccggtggtcctgccgcaggaggaa
atcgccggcgtcatcgagggatttgccacttacggccatcaggacaaacccaagggcgag
gccgcctga

DBGET integrated database retrieval system