KEGG   Sinorhizobium meliloti SM11: SM11_chr1026Help
Entry
SM11_chr1026      CDS       T01885                                 

Gene name
fucA1
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SM11_chr1026 (fucA1)
Enzymes [BR:smx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SM11_chr1026 (fucA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057780..1058448
Genome map
AA seq 222 aa AA seqDB search
MNELQLRQSIIDHCRHMNAIGLNQGTSGNISLRHGGTMLITPSAIPYAEMTPDMIVAMPI
EGEYGAWVGPKKPSVEWPFHLDILRARPDVGAVVHTHASFSTILAMARKPIPACHYMIAA
FGGSDVRVADYARYGTKALSENVLKAMEGRSACLMANHGMIATGSSLEKAMWAAVELETI
AKQYYHVLLIGGPVVLPQEEIAGVIEGFATYGHQDKPKGEAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacttcaactgcgccagtcgatcatcgaccattgccgccacatgaatgcgatc
ggcctcaaccagggcacttcgggcaatatcagcctgcgccacggcggcacgatgctgatc
accccgtctgcgatcccctatgccgagatgacgccggacatgatcgtcgccatgccgatc
gagggcgagtatggcgcctgggtagggccgaagaagccctcggtcgaatggcccttccac
ctcgacattctgcgggcgcggccggatgtcggcgccgtcgttcatacccacgcgagcttc
tcgacgatcctcgcgatggcgcgcaagccgattcccgcctgtcactacatgatcgccgcc
ttcggcggttccgacgtgcgcgtcgccgattacgcccgctacggcacgaaggcgctgtcg
gaaaacgtgctgaaggcgatggaggggcgttccgcctgcctcatggccaatcacggcatg
atcgcgaccggttcgagcctggaaaaggcgatgtgggcggcggtcgagctcgagacgatc
gccaagcaatattaccacgtgctcctgatcggcggtccggtggtcctgccgcaggaggaa
atcgccggcgtcatcgagggatttgccacttacggccatcaggacaaacccaagggcgag
gccgcctga

DBGET integrated database retrieval system