KEGG   Sinorhizobium meliloti SM11: SM11_chr1033Help
Entry
SM11_chr1033      CDS       T01885                                 

Gene name
tpiB
Definition
(GenBank) Triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
smx  Sinorhizobium meliloti SM11
Brite
Enzymes [BR:smx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     SM11_chr1033 (tpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1065010..1065777
Genome map
AA seq 255 aa AA seqDB search
MSKSGLWVGTSWKMNKTLAEAMVFADGLAAADDARDQRIQRFVIPPFTAARQVKERLKAT
SVKVGAQNMHWDDAGAWTGEISPVMLSDCDLDIVELGHSERREHFGETDRTVGLKTAAAV
KHGLVPLICIGETLAQREAGEADTVLKRQVEGAFAFLEGAARKAPVLLAYEPVWAIGVNG
IPATADYADARHRLIGEVAERALGVKVPVLYGGSVNPQNCEELILQPHIDGLFIGRSAWD
VGGYLDILQRVARAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtctggtctctgggtcggcacgagctggaagatgaacaagacgctggccgag
gcaatggtcttcgccgacggtcttgctgccgccgacgatgcgcgcgatcagcggatacag
cgcttcgtcattcctccgttcaccgccgcgcggcaggtgaaggaaaggcttaaggcgacg
agcgtcaaggtcggtgcgcagaacatgcactgggacgatgccggcgcctggaccggcgaa
atttccccggtcatgctgagcgattgcgatctcgacatcgtcgagctcggccacagcgag
cggcgggagcatttcggcgagaccgaccgcaccgtgggcttgaagacggcagccgccgtc
aagcatgggctcgtgccgttgatctgcatcggcgaaactctcgcgcaacgcgaagcgggc
gaggcggatactgtcctgaagcgccaggtggaaggcgcctttgcctttctcgaaggcgcg
gcgcggaaggcgcccgttcttctggcttacgagcccgtctgggcgatcggcgtcaacggc
ataccggcgaccgccgactatgcggacgcccgccatcgcctcattggcgaagtcgccgag
cgtgcactcggcgtgaaggttccggtgctctatggcggcagcgtcaatcctcagaactgc
gaggaattgatcctccaaccccatatcgacgggctcttcatcggccgctccgcctgggac
gtcggcggctatctcgacattttgcaacgcgtagcccgggcgatctga

DBGET integrated database retrieval system