KEGG   Sinorhizobium meliloti SM11: SM11_chr1589Help
Entry
SM11_chr1589      CDS       T01885                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SM11_chr1589 (folK)
Enzymes [BR:smx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SM11_chr1589 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1602741..1603265
Genome map
AA seq 174 aa AA seqDB search
MSPNRSWRHAILGLGGNLGDPRRSMAEALRALDARSDCRVVAVSRLYRTPPWGKTDQDWF
FNACAEVETTLDPEALLAACLDIERAMKRVRMERWGPRTIDIDLLTFGDLNRASATLTLP
HPRMTERGFVLKPLADFAADLAVEGRTVIEWLGRADVTGIEVADESVEWWRAEE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaataggagctggcggcacgcgatactcggtctcggcggcaatctcggcgat
ccgcgccggtcgatggcagaagccctgcgggcgctcgacgcgcggtccgattgccgggtc
gtcgcggtgtcgcggctctaccgcaccccgccatggggcaagacggatcaggattggttc
ttcaacgcctgtgcggaagtcgagacgacgctggatccggaggcattgcttgcggcctgt
ctcgatatcgaacgggccatgaagcgcgtgagaatggagcgctggggtccccgaaccatc
gacatcgatctcctgaccttcggtgacctcaacagggcgagcgcgacgctcacgctgcct
catccgcgcatgaccgaacggggcttcgtgctgaagccgctcgccgactttgcggcagac
cttgccgtcgaaggacggacagtcattgaatggctgggccgggcggatgtgacgggcatc
gaagtggccgacgaaagcgtcgaatggtggcgcgcggaggaatag

DBGET integrated database retrieval system