KEGG   Sinorhizobium meliloti SM11: SM11_chr1589Help
Entry
SM11_chr1589      CDS       T01885                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1602741..1603265
Genome map
AA seq 174 aa AA seqDB search
MSPNRSWRHAILGLGGNLGDPRRSMAEALRALDARSDCRVVAVSRLYRTPPWGKTDQDWF
FNACAEVETTLDPEALLAACLDIERAMKRVRMERWGPRTIDIDLLTFGDLNRASATLTLP
HPRMTERGFVLKPLADFAADLAVEGRTVIEWLGRADVTGIEVADESVEWWRAEE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaataggagctggcggcacgcgatactcggtctcggcggcaatctcggcgat
ccgcgccggtcgatggcagaagccctgcgggcgctcgacgcgcggtccgattgccgggtc
gtcgcggtgtcgcggctctaccgcaccccgccatggggcaagacggatcaggattggttc
ttcaacgcctgtgcggaagtcgagacgacgctggatccggaggcattgcttgcggcctgt
ctcgatatcgaacgggccatgaagcgcgtgagaatggagcgctggggtccccgaaccatc
gacatcgatctcctgaccttcggtgacctcaacagggcgagcgcgacgctcacgctgcct
catccgcgcatgaccgaacggggcttcgtgctgaagccgctcgccgactttgcggcagac
cttgccgtcgaaggacggacagtcattgaatggctgggccgggcggatgtgacgggcatc
gaagtggccgacgaaagcgtcgaatggtggcgcgcggaggaatag

DBGET integrated database retrieval system