KEGG   Sinorhizobium meliloti SM11: SM11_chr1612Help
Entry
SM11_chr1612      CDS       T01885                                 

Gene name
glsA
Definition
probabable glutaminase a protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SM11_chr1612 (glsA)
   00330 Arginine and proline metabolism
    SM11_chr1612 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SM11_chr1612 (glsA)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SM11_chr1612 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1633785..1634732
Genome map
AA seq 315 aa AA seqDB search
MREPKPQEDLQAIIDDIYRELTPRLGEGKVADYIPQLARVDARHFGMAIVTTGGEVYRVG
DAEMPFSIQSISKVFTLTLALGKHGENIWNRVGREPSGSAFNSIVQLEHEGGKPRNPFIN
AGAIRISDLILAGHTPKELIGEIVRFVRYLADDENIVIDHEVARSETATGYRNIALANFM
RSFGRLDHPVEHVLGVYFHHCALAMTCSQLAKAGLFLAAGGTNPLTGHSVVSRQRARRIN
ALMLTCGHYDGSGDFAYRVGLPGKSGVGGGIMAVAPGKASIAVWSPGLNDYGNSLLGSLA
LEMLAARTGWSVFGP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagccgaaaccgcaagaagacctccaggcgatcatcgacgacatctatcgggaa
ctgacgccgcgcctcggcgaagggaaggtcgcggactatatccctcagctcgcacgcgtc
gatgcccgtcacttcggcatggcgatcgtcacgacgggtggcgaggtctatcgcgtcggc
gatgcggagatgccgttctccattcagagcatctccaaggtgttcacgctcacgctggcg
ctgggcaagcacggcgaaaacatatggaaccgggtggggcgagagccttcgggctcggcc
ttcaattcgatcgtccagctcgagcatgagggtggcaagccgcgcaaccccttcatcaat
gccggcgcgatcaggataagcgacctcattctcgccggccacacgccgaaggaactgatc
ggcgagatcgttcgcttcgttcgttacctcgcggatgacgagaacatcgtgatcgaccac
gaagtcgcacgctcggagacagcgaccggataccgcaacatcgcgcttgcgaatttcatg
cggtccttcggccggctcgatcatccggtcgagcacgtgcttggcgtctatttccatcat
tgcgcgctcgccatgacctgcagccagctcgccaaggccgggctgtttctagccgccggc
ggcaccaacccgctgaccggacattcggtcgtgtcgcgccagcgcgcgcggcggatcaat
gcgcttatgctcacctgcggccattatgacggctccggcgattttgcctaccgcgtcggt
ctgccggggaagagcggcgtcggcggcggcatcatggcggtggcgccgggcaaggcatcc
attgccgtctggtcgccgggactcaacgattacggcaattcgctgctggggtcgctggcg
ctggagatgctggctgcgcgtacgggttggtcggtgttcgggccgtaa

DBGET integrated database retrieval system