KEGG   Sinorhizobium meliloti SM11: SM11_chr2148Help
Entry
SM11_chr2148      CDS       T01885                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00790  Folate biosynthesis
smx01100  Metabolic pathways
Module
smx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SM11_chr2148 (folE)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SM11_chr2148 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: AEH79410
UniProt: F7X1N4
Position
2136414..2137028
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPVLDDTGRPTQKEAEEAVRVLLRWAGEDPAREGLKDTPARVAKAYREIFGGY
DLVAEDVLGRTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKI
ARVVDIYARRLQTQEAMTAQIAKAIDETLMPRGVAVMIEAEHLCMAMRGIKKQGATTLTT
TFTGAFKSEPAEQVRFMTMLRGFK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatagtgaagaattttcctgtgctcgacgacacaggtcgtccgacgcagaag
gaagccgaagaagccgttcgcgtcttgttgcgctgggcaggtgaagatccggcacgagaa
ggcctgaaggacacgcctgcgcgtgtcgccaaggcgtatcgggaaattttcggcggctac
gatctcgtggcggaagacgtgctcggacgaaccttcgaggaagtctcaggctacgacgat
atcgtgctcgaaaaggacatccccttctattcgcattgcgagcaccacatggtgccgatc
atcggcaaggcccatatcgcctatctgccgaacggccgcgtgctcggcctttccaagatc
gcccgggtcgtcgatatctacgcccgtcgcctgcagacgcaggaagcgatgacggcgcag
atcgcaaaggccatcgacgagaccctcatgccgcggggcgtggcggtgatgatcgaggcc
gagcacctgtgcatggcgatgcgcggtatcaagaagcagggcgcgacgacgctgacgacc
accttcaccggtgcgttcaagagcgagccggccgaacaggtccgcttcatgacgatgctc
aggggcttcaagtaa

DBGET integrated database retrieval system