KEGG   Sinorhizobium meliloti SM11: SM11_chr2148Help
Entry
SM11_chr2148      CDS       T01885                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2136414..2137028
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPVLDDTGRPTQKEAEEAVRVLLRWAGEDPAREGLKDTPARVAKAYREIFGGY
DLVAEDVLGRTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKI
ARVVDIYARRLQTQEAMTAQIAKAIDETLMPRGVAVMIEAEHLCMAMRGIKKQGATTLTT
TFTGAFKSEPAEQVRFMTMLRGFK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatagtgaagaattttcctgtgctcgacgacacaggtcgtccgacgcagaag
gaagccgaagaagccgttcgcgtcttgttgcgctgggcaggtgaagatccggcacgagaa
ggcctgaaggacacgcctgcgcgtgtcgccaaggcgtatcgggaaattttcggcggctac
gatctcgtggcggaagacgtgctcggacgaaccttcgaggaagtctcaggctacgacgat
atcgtgctcgaaaaggacatccccttctattcgcattgcgagcaccacatggtgccgatc
atcggcaaggcccatatcgcctatctgccgaacggccgcgtgctcggcctttccaagatc
gcccgggtcgtcgatatctacgcccgtcgcctgcagacgcaggaagcgatgacggcgcag
atcgcaaaggccatcgacgagaccctcatgccgcggggcgtggcggtgatgatcgaggcc
gagcacctgtgcatggcgatgcgcggtatcaagaagcagggcgcgacgacgctgacgacc
accttcaccggtgcgttcaagagcgagccggccgaacaggtccgcttcatgacgatgctc
aggggcttcaagtaa

DBGET integrated database retrieval system