KEGG   Sinorhizobium meliloti SM11: SM11_chr2354Help
Entry
SM11_chr2354      CDS       T01885                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SM11_chr2354 (speB)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SM11_chr2354 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2334586..2335542
Genome map
AA seq 318 aa AA seqDB search
MANKSIDHAITAKSLTTAASDPTHAGILSFMRRKYTKELKGVEAVVWGIPFDAATSNRPG
ARFGPQAIRRASAIFDNDPQYPFQRDLFADMATIDYGDCLLDYGNHARTPQTIEREASKI
LKSGAYLLTLGGDHFVTYPILRAHAALHGPLALVQFDAHQDTWPDEKGRIDHGAFVGRAA
REGLIDVERSIQIGIRTHAPEDCGIRIVYGYELEEMRAEEIADTIIRHVDNRPAYLTFDI
DCLDPAFAPGTGTPVAGGPSSAKILSVLRKLGALHIAGSDVVEVAPAYDHADLTAIAGST
IAMYMLGLRAEWLAERRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaagtcgatcgaccacgcgatcactgcaaaatcactgacgacggcggcctcc
gatccgacgcatgccggcatcctttccttcatgcggcggaaatacaccaaggagctcaag
ggtgtggaggcggtcgtctggggaattccgttcgatgcagccacgtcgaatcgccccggc
gcacgcttcgggcctcaggcgatccgccgtgcatcggcgatcttcgacaacgatccgcaa
tatccgttccagcgtgacctgtttgccgacatggcgacgatcgattacggcgattgcctg
ctcgactacggcaaccatgcgaggactccccagaccatcgagcgcgaggcgtcgaaaatc
ctgaagtcgggcgcctacctgctgacgctcggcggcgaccacttcgtcacctatcccatc
ctgagggcccatgcagccctgcacgggcccctcgccctcgtccagttcgatgcccatcag
gacacctggccggacgagaaaggccgcatcgatcatggcgccttcgtcggccgcgcggca
cgcgaggggctgatcgacgtggaacgctcgatccagatcggcatccggacgcatgcaccg
gaggattgcggcattcggatcgtctacggctacgagctcgaggagatgcgcgccgaggag
atcgccgataccatcatccgccatgtcgacaatcgtcccgcctatctgaccttcgatatc
gattgcctcgacccggcctttgcgcccggcacgggcacgcccgtggccggcggcccctcg
agcgcaaagatactatcggtcctgcgcaaactcggagcgcttcatatcgccggaagcgac
gtggtcgaggtggcgcccgcctacgaccacgcggacctcaccgccattgctggctcgacc
atcgccatgtatatgctgggcctgcgtgccgagtggctggcggagaggcgcggctga

DBGET integrated database retrieval system