KEGG   Sinorhizobium meliloti SM11: SM11_chr2791Help
Entry
SM11_chr2791      CDS       T01885                                 

Gene name
acsA3
Definition
probabable acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:smx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smx00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:smx00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:smx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2769323..2771008)
Genome map
AA seq 561 aa AA seqDB search
MLAALQQSQCSRPMLPKIEDYDELYREFRWRIPERFNIGVAVSDAWAARDPERICLQHFS
PDGAHLALTYGDFAARSSAFAGGLAAHDVSPGERVAILLPQGFEAAIAHAAIYKLGAIAL
PLALLFGVEALAYRLKDAGAAAVVTNRFGYERLAAIRGELPELRMVVLAEEDEKPGTVRF
RDIAAGQGRFDPAETKPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPQP
GDRMWTPADWAWAGGLLNALLPSLFFGVPVVSSPAQKFDAHTAFRIIEEMEVRNAFIPPT
ALRLLKSVERPRDRCALKLRTVGSAGEALGRETFEWARAALGVEVSEFYGQTECNIVISS
ATGLGVAKAGSMGKAAPGHQVAIIDGEGRVLPPGTVGQVAIRRPDPVMFLGYWRNEEATE
AKFIGDWMTTGDQGVMDEEGYFTFFGRDDDVITSSGYRIGPSEIEDCLAGHPDVQLAAAV
GKPDPLRTEIVKAYVVLKPGVAAGDETAAGIRDWVKNRLSMHEYPREIAFVDSLPLTTSG
KVIRRLLREKAAAEARAASGG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgttagctgcgttgcagcaatctcagtgcagcaggcccatgctcccgaagatcgaagac
tacgacgaactctatcgcgaattccgctggcggatccctgagaggttcaatatcggcgtg
gccgtgagcgacgcctgggccgcgcgtgatccggagcgcatctgtcttcagcatttcagc
ccggacggcgcgcatcttgcgctgacctatggcgacttcgccgcgcgttcgtccgccttt
gccggcgggcttgccgcgcatgacgtgagccccggcgaacgcgtcgccatcctgctgccg
cagggtttcgaggcggcgatcgcccatgcggcgatctataaactcggcgccatcgcgctg
ccgctggcactgctcttcggcgtcgaggcgcttgcctatcggctgaaggatgcgggcgcg
gcagcagtcgtcaccaatcgcttcggctatgagcggcttgcggcgatccgcggcgagctg
ccggaacttcgtatggtcgtcctggccgaggaggacgagaagcccggcacggttcgtttc
cgcgatatcgcggcagggcagggccgcttcgaccccgcggagacgaagccggacgatccg
gcgctgatgatctacacctcgggaacgaccggaccgccgaagggggccttgcacgggcac
cgcgtgctgctcggccatctgccgggatttcagttccatcatcatttcctgccacagccg
ggcgaccgcatgtggacgcccgccgactgggcctgggcaggcggtctcctgaacgctctg
ctgccgtcgcttttcttcggtgtgcccgtggtttcctcgcctgcgcagaaattcgatgcc
catacggcgttccggatcatcgaagagatggaggtgcgcaacgccttcatcccgccgacg
gcgctcaggctcctcaaatccgtcgagcggccgcgcgatcgctgcgcgctcaagctccgc
accgtcggttcggcgggagaggcgctcgggcgggagaccttcgaatgggccagggcggcg
ctcggcgtcgaggtgagcgaattctacggccagacggaatgcaatatcgtcatctcctct
gcgaccggtctcggcgtggcgaaggccggctcgatgggcaaggcggcaccgggtcatcag
gtcgcgatcatcgacggcgaggggcgggtgctgccgcccggcacggtcgggcaggtggcg
atcaggcgtcccgatccggtgatgttcctcggctattggcgcaacgaagaggcgaccgag
gccaagtttatcggcgactggatgaccaccggcgaccagggcgtcatggacgaagagggc
tatttcacctttttcggccgtgacgacgacgtcatcacgtcgtcaggctatcgcatcggt
ccgagcgagatcgaggattgtctcgccgggcacccggacgtccagctcgccgcggccgtc
ggcaaaccggacccgctccggaccgagatcgtcaaggcctatgtcgtgctgaaacccggc
gtcgctgccggcgacgagaccgcggcagggatccgcgactgggtgaagaacaggctgtcg
atgcatgaatatccgcgcgagatcgctttcgtcgacagcctgcctttgaccacctcgggc
aaggtgatccgccggcttctgcgggagaaggcggcggcagaggcgcgcgccgcgtccggc
ggctga

DBGET integrated database retrieval system