KEGG   Sinorhizobium meliloti SM11: SM11_chr2791Help
Entry
SM11_chr2791      CDS       T01885                                 

Gene name
acsA3
Definition
(GenBank) probabable acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00010  Glycolysis / Gluconeogenesis
smx00620  Pyruvate metabolism
smx00640  Propanoate metabolism
smx00680  Methane metabolism
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
smx01130  Biosynthesis of antibiotics
smx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SM11_chr2791 (acsA3)
   00620 Pyruvate metabolism
    SM11_chr2791 (acsA3)
   00640 Propanoate metabolism
    SM11_chr2791 (acsA3)
  Energy metabolism
   00680 Methane metabolism
    SM11_chr2791 (acsA3)
Enzymes [BR:smx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SM11_chr2791 (acsA3)
Lipid biosynthesis proteins [BR:smx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SM11_chr2791 (acsA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEH80038
UniProt: F7X703
Position
complement(2769323..2771008)
Genome map
AA seq 561 aa AA seqDB search
MLAALQQSQCSRPMLPKIEDYDELYREFRWRIPERFNIGVAVSDAWAARDPERICLQHFS
PDGAHLALTYGDFAARSSAFAGGLAAHDVSPGERVAILLPQGFEAAIAHAAIYKLGAIAL
PLALLFGVEALAYRLKDAGAAAVVTNRFGYERLAAIRGELPELRMVVLAEEDEKPGTVRF
RDIAAGQGRFDPAETKPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPQP
GDRMWTPADWAWAGGLLNALLPSLFFGVPVVSSPAQKFDAHTAFRIIEEMEVRNAFIPPT
ALRLLKSVERPRDRCALKLRTVGSAGEALGRETFEWARAALGVEVSEFYGQTECNIVISS
ATGLGVAKAGSMGKAAPGHQVAIIDGEGRVLPPGTVGQVAIRRPDPVMFLGYWRNEEATE
AKFIGDWMTTGDQGVMDEEGYFTFFGRDDDVITSSGYRIGPSEIEDCLAGHPDVQLAAAV
GKPDPLRTEIVKAYVVLKPGVAAGDETAAGIRDWVKNRLSMHEYPREIAFVDSLPLTTSG
KVIRRLLREKAAAEARAASGG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgttagctgcgttgcagcaatctcagtgcagcaggcccatgctcccgaagatcgaagac
tacgacgaactctatcgcgaattccgctggcggatccctgagaggttcaatatcggcgtg
gccgtgagcgacgcctgggccgcgcgtgatccggagcgcatctgtcttcagcatttcagc
ccggacggcgcgcatcttgcgctgacctatggcgacttcgccgcgcgttcgtccgccttt
gccggcgggcttgccgcgcatgacgtgagccccggcgaacgcgtcgccatcctgctgccg
cagggtttcgaggcggcgatcgcccatgcggcgatctataaactcggcgccatcgcgctg
ccgctggcactgctcttcggcgtcgaggcgcttgcctatcggctgaaggatgcgggcgcg
gcagcagtcgtcaccaatcgcttcggctatgagcggcttgcggcgatccgcggcgagctg
ccggaacttcgtatggtcgtcctggccgaggaggacgagaagcccggcacggttcgtttc
cgcgatatcgcggcagggcagggccgcttcgaccccgcggagacgaagccggacgatccg
gcgctgatgatctacacctcgggaacgaccggaccgccgaagggggccttgcacgggcac
cgcgtgctgctcggccatctgccgggatttcagttccatcatcatttcctgccacagccg
ggcgaccgcatgtggacgcccgccgactgggcctgggcaggcggtctcctgaacgctctg
ctgccgtcgcttttcttcggtgtgcccgtggtttcctcgcctgcgcagaaattcgatgcc
catacggcgttccggatcatcgaagagatggaggtgcgcaacgccttcatcccgccgacg
gcgctcaggctcctcaaatccgtcgagcggccgcgcgatcgctgcgcgctcaagctccgc
accgtcggttcggcgggagaggcgctcgggcgggagaccttcgaatgggccagggcggcg
ctcggcgtcgaggtgagcgaattctacggccagacggaatgcaatatcgtcatctcctct
gcgaccggtctcggcgtggcgaaggccggctcgatgggcaaggcggcaccgggtcatcag
gtcgcgatcatcgacggcgaggggcgggtgctgccgcccggcacggtcgggcaggtggcg
atcaggcgtcccgatccggtgatgttcctcggctattggcgcaacgaagaggcgaccgag
gccaagtttatcggcgactggatgaccaccggcgaccagggcgtcatggacgaagagggc
tatttcacctttttcggccgtgacgacgacgtcatcacgtcgtcaggctatcgcatcggt
ccgagcgagatcgaggattgtctcgccgggcacccggacgtccagctcgccgcggccgtc
ggcaaaccggacccgctccggaccgagatcgtcaaggcctatgtcgtgctgaaacccggc
gtcgctgccggcgacgagaccgcggcagggatccgcgactgggtgaagaacaggctgtcg
atgcatgaatatccgcgcgagatcgctttcgtcgacagcctgcctttgaccacctcgggc
aaggtgatccgccggcttctgcgggagaaggcggcggcagaggcgcgcgccgcgtccggc
ggctga

DBGET integrated database retrieval system