KEGG   Sinorhizobium meliloti SM11: SM11_chr2972Help
Entry
SM11_chr2972      CDS       T01885                                 

Gene name
exoN2
Definition
UTP--glucose-1-phosphate uridylyltransferase protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smx00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smx00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smx00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smx00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2950505..2951413)
Genome map
AA seq 302 aa AA seqDB search
MHCKEVPMTDKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGI
EHLIFVTGRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPKAGTTSFTRQQAPLG
LGHAVWCARDLVGNEPFALLLPDMIMKGEKGCLKGMVELYEESGGNVVAVEECAPDQAHK
YGIVGVGETVGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNEIQ
LTDGMVKLAEAQPFAAYHFRGDTYDCGAKDGFILANVAFALERGDIRPIVEGPLKTLLQG
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcaaggaggtgccaatgaccgacaagcgcaaagtccgcaaagccgttttcccc
gttgcaggtctcgggacccgtttccttccggcgaccaaggcggttccgaaggagatgctg
acggtggtggacaagccggtcatccaatatgttgtcgatgaggcgctcgaagccggcatc
gagcatctgattttcgtgaccggccgcagcaaggcggtcatcgaggactatttcgacatc
caggtcgaattggaccagacgctgcgcgagcgcaacaaaaaggcggagatcgagctcctc
gaagccatgctgccgaaggccggcaccacgagcttcacccgccagcaggcacccctgggc
ctcggccatgccgtctggtgcgcccgcgatctcgtcggcaatgagcccttcgctctgctc
ctgcccgatatgatcatgaagggcgagaagggttgcctcaagggcatggtcgagctctac
gaagagtccggcggcaacgtcgtcgcggtggaggaatgcgcgcccgaccaggcgcataaa
tacgggatcgtcggagtgggcgagacggtcggcgacggtttcaggatcaccaggatggtc
gagaagccggccaaggggacggctccgtcgaacttcttcatcaatggccgctacatcctg
cagccggagattttcccgatcctggaaacgcaggaacgcggcgccggcaacgagatccag
ctgaccgacggcatggtgaagcttgccgaggcccagcccttcgccgcctatcacttccgc
ggcgatacgtatgactgcggcgccaaggacggcttcatcctggcgaacgtcgccttcgct
ctcgagcgcggcgatatccgccccatcgtggaaggaccgttgaagacgctcctgcagggt
cttaagtaa

DBGET integrated database retrieval system