KEGG   Sinorhizobium meliloti SM11: SM11_chr2988Help
Entry
SM11_chr2988      CDS       T01885                                 

Gene name
pldB
Definition
lysophospholipase L2 protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SM11_chr2988 (pldB)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SM11_chr2988 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2972595..2973542
Genome map
AA seq 315 aa AA seqDB search
MPGDPVVGFFDGARNRKIRYAVFRSKAPVIRGTIVLLQGRNESIEKYFETIGDLMAAGFW
VATFDWRGQGGSERLSPQWTHGHVEDFTDYERDLTIFLDEIVLPDTRLPFSIVAHSMGAL
VALSLAPMLASRIDRMVLLAPFVGLGGQAIGERGIAAIATVMRWIGLGRLALSSDKGNGT
PFRGNVLTADDRRYARNLALIDARPQLRVGPPTARWLSEAFRTIRRVLKHEHLTRITIPA
VILAPTADKLVPYLPVERLASNFRAGHLIPIDGARHELLQEADRYRAQAMAAILAFLPGA
DAEDPASLPRQLEEA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcgatccggtggttggctttttcgacggagcccgcaaccgcaagatccgctac
gcggtgttcaggtcgaaggccccggtcattcgcggcaccatcgtcctgctgcagggtcgc
aacgagtcgatcgagaaatacttcgaaacgatcggcgatctcatggcggccggtttctgg
gtcgcgaccttcgactggcgcggacagggcggctccgagcggctgtcgccgcaatggacc
cacggccatgtggaggatttcaccgattacgagcgcgacctgacgatttttctcgatgag
atcgtccttcccgacacccgcctgcccttctcgatcgtcgcccattcgatgggggcgctc
gtcgccctgtcgctcgctcccatgctcgcaagccgcatcgaccggatggtgctgcttgcc
cccttcgtcggtctggggggccaggcgatcggcgaacggggtatcgcagcgatcgcgacg
gtcatgcgctggatcggcctcgggaggctggcgctgagttccgacaaaggcaacggtacc
ccttttaggggcaatgttctgaccgcggacgaccggcgctacgcccgcaacctggcgctc
atcgatgcgcgtccgcaactgcgggtcggaccgcccacggcccgctggctgagcgaggcc
ttccgaacgatccggcgcgtcctcaagcacgaacatctgacgaggatcaccataccggcc
gtcatactcgccccgacggccgataagctcgtgccgtatctcccggtcgagcggttggcc
agcaatttccgtgcggggcatctgatcccgatcgacggcgcgcggcacgaactcctgcag
gaggccgaccgctatcgcgcccaggcgatggccgcgatcctggcctttctgccgggcgcc
gatgcggaggaccccgcgtccctgccgcgacagttggaagaggcttaa

DBGET integrated database retrieval system