KEGG   Sinorhizobium meliloti SM11: SM11_chr3066Help
Entry
SM11_chr3066      CDS       T01885                                 

Gene name
xylA
Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SM11_chr3066 (xylA)
   00051 Fructose and mannose metabolism
    SM11_chr3066 (xylA)
Enzymes [BR:smx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SM11_chr3066 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3055101..3056411)
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIAKIKYEGPESTNPLAFRHYNPDDVVLGKRMEDHLRFAVAYWHTFVWPGGDP
FGGQTFERPWFKDSMEAAKLKADVAFEFFQLLGVPYYCFHDADVRPEGRNFAENTSNLNA
IVDYFAGKQEETGVKLLWGTANLFSNRRFMAGAATNPDPDVFAFAAATVKTCIDATQRLD
GENYVLWGGREGYETLLNTDLKRELDQLGRFLNLVVEYKHRIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKTGGTNFDAKLRRQSIDPEDLLIGHIGGMD
CCARGLKAAAKMIEDKALSAPLEARYAGWNVPEAKKMLDGGFSLEEIEAWVLKSDVNPQP
KSGRQELLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgggatttttcggcgatatcgccaagatcaaatatgagggaccggaaagcacc
aatccgctcgccttccgccattacaatccggacgacgtcgtcctcggcaagcggatggag
gatcatctgcgcttcgccgtcgcctactggcacaccttcgtctggccgggcggcgatccc
ttcggcgggcagaccttcgaacgcccctggttcaaggattcgatggaagccgccaagctg
aaggcggatgtcgccttcgaattcttccagcttctcggcgtaccctactactgcttccac
gacgcggacgtgcgcccggaggggcggaacttcgccgagaacacgagcaatctcaacgcg
atcgtcgattatttcgccgggaagcaggaagagaccggcgtcaagctgctgtggggcacg
gcgaacctcttttcaaaccgccgcttcatggcgggggctgcgacgaacccggacccggac
gtcttcgcctttgccgccgcgacggtgaagacctgcatcgacgcgacgcagcggctggat
ggcgagaactatgtgctctggggcggacgcgagggctatgagaccctgctcaacaccgac
ctgaagcgcgagctcgatcagctcggccgcttcctcaacctggtcgtcgaatacaagcac
aggatcggcttcaagggcacgatcctgatcgagccgaagccgcaggagccgaccaagcac
cagtacgactacgacgtcgcgaccgtctatggcttcctcaagagatacggcctcgagaac
gaggtgaaggtcaacatcgagcagggccacgcgatccttgccggacattccttcgagcac
gagctggcgctcgccaatgcgctcggcatcttcggttcgatcgacatgaaccgcaacgac
taccagtccggctgggacaccgaccagttcccgaacaacgtgccggaaatggcgctcgcc
tattaccacgtgcttgcgggcggcggcttcaagaccggcggcacgaacttcgacgcgaag
ctgcgccggcagtcgatcgaccccgaagacctgctgatcggccatatcggcggcatggat
tgctgcgcgcgcggcctcaaggcggccgcgaagatgatcgaggacaaggcgctctccgca
ccgctcgaagcgcgctacgccggctggaacgtgccggaggcgaagaagatgctcgacggc
ggcttctcgctcgaggagatcgaggcctgggtgctcaagtccgacgtcaacccgcagccg
aaatccggcaggcaggagcttctggaaaacgtggtgaaccgctacgtctga

DBGET integrated database retrieval system