KEGG   Sinorhizobium meliloti SM11: SM11_chr3165Help
Entry
SM11_chr3165      CDS       T01885                                 

Gene name
dxr
Definition
probabable 1-deoxy-d-xylulose 5-phosphate reductoisomerase protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:smx00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3167817..3168992
Genome map
AA seq 391 aa AA seqDB search
MASGDDLKRRLTILGSTGSIGTSTLDVIERLGGRDRFEIAALTGNGNIPLLAEQARRIGA
ELAVTADEDRYGELKDALSGSGIEVAAGRSGLTEAAERDAGWVMAAIVGNAGLGPTLAAA
RRGADIALANKECLVSAGSLFIDAVAEGGGRLLPVDSEHNAIFQVLENDQRHAVERIVLT
ASGGPFRTKTLDEMRHVTADVARAHPNWSMGLKISIDSASMFNKALEMIEARHLFRLRPE
QIEVIVHPQSVVHSMVGYTDGSVLAQLGCPDMRTAIGYALSYPKRCDLPVERLDFARLAR
LDFEAPDEVRFPAIKLARRAMEEGGVQGAVLNGAKETALDAFIKGRIGFLAMAEIVEKVM
DGLAGLPAATSMDDVFAADERARRAAAEMIR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggcgatgacttgaagcgccgtctgacgatattgggctccaccggatcgatc
gggaccagcacgctcgacgtgatcgagcgcctcggcggacgcgatcgtttcgagatcgcc
gccctgaccggcaacggcaatataccgctgctggccgagcaggcgcgccgcatcggcgcc
gagctcgcggtaaccgccgacgaggatcgctatggcgagctcaaggatgcgctgagcggc
agcggcatcgaggtcgccgccggacgaagcggcctcaccgaagcggccgagcgggatgcc
ggctgggtcatggcggcgatcgtcggcaatgccggcctcggccccaccctggcggctgcc
cgccgcggcgcagacatcgcgcttgccaacaaggaatgtctcgtttccgccggcagcctt
ttcatcgatgccgtggccgagggcggcggccggttgctgcccgtcgacagcgaacacaat
gcgatcttccaggtgctggaaaacgatcagcgccacgccgtggaacgcattgtcctcacc
gcttccggcggccctttccgcaccaagacgctcgacgaaatgcggcacgtgaccgcggat
gtggcccgcgcccatccgaactggtcgatgggcctcaagatatcgatcgacagcgcctcg
atgttcaacaaggcgctcgagatgatcgaggcgcgccacctcttccgtctcaggccggag
cagatcgaggtgatcgtccacccgcaatcggtggttcactccatggtcggctatacggac
ggctccgtactcgcacagctcggctgccccgacatgcgcaccgcaatcggctatgccctg
tcctacccgaaacgctgcgacctgccggtcgagcgcctcgacttcgccaggctcgcccgg
cttgatttcgaggcgccggacgaggtccgcttcccggcgatcaaactcgcgcgccgggca
atggaggaaggcggcgtgcagggcgcggtgctgaacggcgccaaggagaccgccctcgat
gccttcatcaagggccgcatcggcttcctcgccatggcggaaatcgtcgaaaaggtgatg
gacgggcttgccggcctgccggccgccacgagcatggacgacgtctttgcggccgatgaa
agagcccggcgggcggctgccgagatgatccggtag

DBGET integrated database retrieval system