KEGG   Sinorhizobium meliloti SM11: SM11_chr3180Help
Entry
SM11_chr3180      CDS       T01885                                 

Gene name
argI1
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00220  Arginine biosynthesis
smx00330  Arginine and proline metabolism
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01130  Biosynthesis of antibiotics
smx01230  Biosynthesis of amino acids
Module
smx_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SM11_chr3180 (argI1)
   00330 Arginine and proline metabolism
    SM11_chr3180 (argI1)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SM11_chr3180 (argI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEH80417
UniProt: F7XAC9
Position
3188932..3189855
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANH
PGANNLQSVAAFARALDEAVHDTARKGHFPIILGGDHALSMGSVSGMARHAQDVGRPLFV
LWLDAHADFNSPATSPSGNMHGMPVAFFCGEAEFAPILPKDRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPGVG
TTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcacattgatcggcgcacccatcgaggaaggctcgggccgccgcggcgca
gccatggggccgacggcgctcaggatcgccggcatagacacggtcctcgccgaactcggc
catacggtcaatgacgagggggatctgaggccgctgcccgcgcgcgatctcgccaaccat
cccggcgccaacaatctgcagtccgttgcagctttcgcgcgcgcgctcgacgaagccgtg
cacgataccgcgcgcaagggacatttccccatcattctcgggggcgaccacgcgctgtcg
atgggcagcgtctccggcatggcgcgtcacgcccaggacgtcggccggcccctcttcgtc
ctctggctcgacgcgcatgccgacttcaactcgcctgcgacctcgccctccggaaacatg
cacggcatgccggtcgccttcttctgcggcgaagcggagttcgccccgatccttccgaag
gaccggccgctggtcgacccgaagaaggtctatcaggtcggaatccgctcggtcgacgcg
cgtgagcgcgaggaaatcgccgagcacggcgtcaatgtcttcgatatgcgggccatcgac
gagatgggcatggcccacatcatccgtcagatcgtcgacgaggttcgcgccgccaacggc
ctgctgcatgtgagcctcgacgtcgatttcatggatccggaacttgcccccggcgtgggc
acgacggtcccgggcggcgcgaccttccgcgaggcgcacctcatcatggaagtgctgtgc
gacagcggcctcgtctcttccctcgatgtcgtcgagctcaacccgttcctcgacgaccgg
ggcaagagcgcgcgcattctggtcgaactgacggcaagcctcttcggccgccgtatcctt
gatcgtccgactcgcgcggcctga

DBGET integrated database retrieval system