KEGG   Sinorhizobium meliloti SM11: SM11_chr3231Help
Entry
SM11_chr3231      CDS       T01885                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00020  Citrate cycle (TCA cycle)
smx00310  Lysine degradation
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
smx01130  Biosynthesis of antibiotics
smx01200  Carbon metabolism
Module
smx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SM11_chr3231 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SM11_chr3231 (sucB)
Enzymes [BR:smx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SM11_chr3231 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Fim-adh_lectin
Motif
Other DBs
NCBI-ProteinID: AEH80468
UniProt: F7X0D2
Position
complement(3245120..3246373)
Genome map
AA seq 417 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPAAGTLSEIV
AQAGETVGLGALLGQIAEGAGAAAAAPAAAEKKPEPAAATAAPAAAAQPAAAAATQTSTS
MPPAPAAAKLIAENNLSADQIDGSGKRGQVLKGDVLAAVAKGISAPAAAEPAKVQARAPA
PAEDAAREERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRSKYKDIFEKKH
GVKLGFMGFFTKAVTHALKELPAVNAEVDGTEIIYKNFCHVGVAVGTDKGLVVPVVRDAD
QMSIAEIEKEIGRLGKAARDGTLSMADMQGGTFTISNGGVYGSLMSSPILNAPQSGILGM
HKIQDRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaaatccgcgttcccacccttggcgaatccgtcagcgaagcgaccgtcggc
acctggttcaagaaggtcggcgacgcgatcaaggccgacgagccgatcctcgagctcgag
accgacaaggtgacgatcgaagttccggccccggccgccggcacgctcagcgaaatcgtc
gcgcaggcgggcgaaaccgtgggtctcggcgcgctgctcgggcagatcgccgagggcgcg
ggtgctgccgccgctgcgccggctgcggccgagaagaagcctgaacctgctgccgccacc
gctgctccggctgcggccgcacagccggccgccgctgccgcgacgcagacgtccacgtcg
atgccgccggccccggccgccgccaagctcatcgccgagaacaatctttccgccgatcag
atcgacggctcgggcaagcgcggccaggtgttgaagggtgacgtgctcgcggccgtcgcc
aagggcatttcggctccggctgcagccgaaccggccaaggtccaggcccgcgcgccggcg
ccggcggaagatgccgcccgcgaagagcgcgtgaagatgacccgcctgcgccagacgatc
gcccggcgtttgaaggacgcgcagaacaccgcggctatgctcaccacctataacgaggtg
gacatgagcgccgtcatgagcctgcgctcgaagtacaaggacatcttcgagaagaagcac
ggcgtgaagctcggcttcatgggcttcttcaccaaggccgtgacgcatgcgctgaaggag
ttgccggctgtcaacgccgaggtcgacggcaccgagatcatctacaagaacttctgccac
gtcggcgtcgccgtcggcaccgacaagggtctcgtcgtgccggtcgtgcgcgatgccgac
cagatgtcgatcgccgagatcgagaaggaaatcggccgtctcggaaaggcagcgcgcgac
ggtacgctgtccatggccgacatgcagggcggcaccttcaccatctccaacggcggcgtc
tacggttcgctgatgtcctcgccgatcctcaacgctccgcaatcgggcatcctcggcatg
cacaagatccaggaccgcccggtcgcgatcggcggtcaggtcgtcatccgcccgatgatg
tatctggcgctctcctacgatcaccgcatcgtcgacggcaaggaagcggtgaccttcctc
gtgcgcgtcaaggaaagcctcgaggatccggaacgcctggtgctggatctctag

DBGET integrated database retrieval system