KEGG   Sinorhizobium meliloti SM11: SM11_chr3234Help
Entry
SM11_chr3234      CDS       T01885                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00020  Citrate cycle (TCA cycle)
smx00640  Propanoate metabolism
smx00660  C5-Branched dibasic acid metabolism
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
smx01130  Biosynthesis of antibiotics
smx01200  Carbon metabolism
Module
smx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SM11_chr3234 (sucC)
   00640 Propanoate metabolism
    SM11_chr3234 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SM11_chr3234 (sucC)
Enzymes [BR:smx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SM11_chr3234 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEH80471
UniProt: F7X0D5
Position
complement(3250682..3251878)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLKSYGAPVAEGVAIFSADEAEAAAKKLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAKSVDEVVANAKDMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYL
SILVDRSVGQVAFVVSTEGGMDIEAVAEHTPEKIVTVAIDPEKGVTAENLKTLADALKLE
GEARADAEKLFPILYKAFVEKDMSLLEVNPLIVMTNGRMRVLDAKVSFDGNALFRHEDVV
ALRDTTEEDDKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTQAFKIITADPAVKGILVNIFGGIMKCDVIAEGVLAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaataccaggccaaggctctgttgaagagctatggcgcgccggtcgcg
gaaggcgtcgcgatcttctccgccgacgaggccgaggcggccgcgaagaagctgccgggg
ccgctttacgtggtgaagagccagatccacgccggcggccgcggcaagggcaagttcaag
gaactcggccccgatgcgaagggcggcgtgcgcctggccaagtcggtggacgaggtcgtc
gccaatgccaaggacatgctcggcaacacgctggtgaccaagcagaccggtccggccggc
aagcaggtcaaccgcctctatatcgaggacggcgccgatatcgaccgcgagctctatctc
tcgatcctcgtcgatcgctccgtcggccaggtggccttcgtcgtttcgaccgagggcggc
atggatatcgaagcggtcgccgaacatacgccggagaagatcgtcaccgttgcgatcgat
ccggaaaagggtgtgaccgcagagaatctgaagacgctggccgacgcgctgaagctcgaa
ggcgaagcgcgtgccgacgccgagaagctcttcccgatcctctacaaggcattcgtcgaa
aaggacatgagcctgctcgaggtcaatccgctgatcgtcatgacgaacggccggatgcgc
gtcctcgacgccaaggtctccttcgacggcaatgcgctcttccgccatgaggacgtggtc
gcgctgcgcgacacgacggaagaggacgacaaggaaatcgaggcgtcgaaatacgacctc
gcctatgtcgccctggacggcaatatcggctgtatggtcaacggcgccggtcttgccatg
gcgacgatggacatcatcaagctctacggcgccgagcccgcgaacttcctcgatgtcggc
ggcggcgcctcgaaggaaaaggtcacccaggccttcaagatcatcacggccgatccggcg
gtgaagggcatcctcgtcaacatcttcggcggcatcatgaaatgcgatgtcatcgccgag
ggcgtgctcgcagcggtcaaggaagtcggcctcaaggtgccgctcgtcgtgcgcctggaa
ggcaccaatgtcgagctcggcaagaagatcatcaatgaatcgggcctcaacgtgatttcc
gccgatgatctggacgacgccgcccagaagatcgttgcagccgtgaagggagcctga

DBGET integrated database retrieval system