KEGG   Sinorhizobium meliloti SM11: SM11_chr3250Help
Entry
SM11_chr3250      CDS       T01885                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor subunit protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00020  Citrate cycle (TCA cycle)
smx00190  Oxidative phosphorylation
smx00650  Butanoate metabolism
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
smx01130  Biosynthesis of antibiotics
smx01200  Carbon metabolism
Module
smx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SM11_chr3250 (sdhD)
   00650 Butanoate metabolism
    SM11_chr3250 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SM11_chr3250 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEH80487
UniProt: F7X0F1
Position
complement(3266889..3267269)
Genome map
AA seq 126 aa AA seqDB search
MNMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALS
NPFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgcacacctctcggcaaggtccggggtctcggttcggcaaaggaaggcacg
gatcacttctggcggcagcgcctcacggccgtcgccagcattcctctcacgatcttcttc
gtcgtctttctcgcccattatgcgggcgcaccgcatgcggaactgatcgcggccctttcg
aacccgttcgtggcggtgaccatgggtctgatggtcgtcgccggcctcgttcacatgaag
atcggcatgcaggtcatcatcgaggactacgtccatggggagggcgccaagatagcgctt
ctcatgctcaacacattcttcacgatcgcggtcggcgggctctgtcttttcgccgtcctg
aagatcgcatttgcagggtaa

DBGET integrated database retrieval system