KEGG   Sinorhizobium meliloti SM11: SM11_chr3306Help
Entry
SM11_chr3306      CDS       T01885                                 

Gene name
galM
Definition
aldose 1-epimerase protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smx00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smx00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3317550..3318566
Genome map
AA seq 338 aa AA seqDB search
MGTDTEIFGHLPSGEPVQRVTLKGGGLTASVITWGSVIQDLRLEGHAAPLVLGFENFESY
PAHSSYFGATPGRNANRIGAGRFALEGKAYQLELNESGATHLHGGSDNIAKRNWSIRRRA
EDSVTLEITDPDGRAGYPGNCTITCTYTLKPGGTLNVVYETETDAPTLANVCQHSYFNLD
GGSDAFGHDIMIAADHYLPTDERQIPTGEIRPVAGTAFDLREMTSLGRQLDGGGIAYDHN
FCLSPERVQKRSVALVRSINSGVSLEVLTTEPGVQLYTGEKLDVPVPGLEGRRYGPFAGF
CLETQIWPDAVNHEGFPKAVLRPGETLRQETDYVFTKN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagacacggaaatcttcggccacctgccctccggcgagcccgtacagcgcgtg
acgcttaagggcggcgggctgacggcgtcggtgatcacctggggctcggtcatacaggac
ctgcggctcgaaggacatgcagccccgctcgtgctcggcttcgagaatttcgaaagctat
ccggcccattcctcctatttcggcgccacccccggccgcaacgccaaccgcatcggcgcc
ggccgcttcgcgctcgaaggcaaggcctatcagctcgagctcaacgagagcggcgccacg
catctccacggcggcagcgacaatatcgccaagcgcaactggtcgatccgcaggcgggct
gaagacagcgtaacgctcgagatcaccgatccggacggccgtgccggctacccgggcaat
tgcacgatcacctgcacctatacgctgaaaccgggcggcacgctcaacgtcgtctacgaa
actgagaccgacgcgccgaccctcgccaatgtctgccagcacagctatttcaacctcgac
ggcggctcggacgcattcggccacgacatcatgatcgcggcagaccactacctgcccacc
gacgagcggcagattccgacgggcgagatccgccccgttgccggcaccgccttcgatctg
cgcgaaatgacctcgcttggaaggcagctggacggcggcggaatcgcctatgaccacaat
ttctgcctctcgccggagcgcgtgcagaagcgctccgtggcgctcgtacgcagcatcaat
tccggtgtgtcgctggaagtgctgacgacggagcccggcgtgcagctctataccggagaa
aagctcgacgtaccggttcccggcctcgaaggccgccgttacggccccttcgccggcttc
tgcctcgaaacgcagatctggcccgatgcggtgaaccacgaaggtttcccgaaggcggtg
ctgagaccgggcgaaacgctccggcaggaaacggattacgttttcacgaagaactga

DBGET integrated database retrieval system