KEGG   Sinorhizobium meliloti SM11: SM11_chr3347Help
Entry
SM11_chr3347      CDS       T01885                                 

Definition
putative arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SM11_chr3347
Enzymes [BR:smx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SM11_chr3347
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SM11_chr3347
Lipid biosynthesis proteins [BR:smx01004]
 Fatty acid synthase
  Component type
   SM11_chr3347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3357805..3358446)
Genome map
AA seq 213 aa AA seqDB search
MALKDFLPILFGLTMTIVLSAAARAEPVSLVGFGDSLMAGYQLPPEDAFPARLEKALKEK
GIDVTIANAGVSGDTTSSGLARIDWSIPEGTDGVILELGANDALRGIPPEETRKNLEAMV
ARLKERGVAVLLAGMMAPPNMGPDYAARFNPIYPDLAKEHNLVFYPFFLDGVVTEVGLKL
DDGMHPNGGGVGVMVDRFLPTAELFVRSLAKGE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcattaaaagactttctgcccattttattcggcctgacaatgacaatcgtgttatcg
gcggcggctcgcgccgagcccgtcagcctcgtcggcttcggcgacagcctgatggccggc
taccaactccccccggaagatgccttccccgcccgcctcgaaaaggccctgaaggaaaag
gggatcgacgtcacgatcgccaatgccggcgtttccggcgacacgacctccagcggtctc
gcccgcatcgactggtcgatccccgagggcaccgacggcgtcatcctcgaactcggcgcc
aacgacgcgttgcgcggcatccctccggaggagacgcgcaagaatctggaggcgatggtc
gcacggctcaaggagcgcggcgtcgccgtcctgctcgcgggaatgatggcgccgccgaac
atggggccggattatgcggcgcgcttcaatccgatctatcccgacctcgcaaaggaacac
aatctcgttttctaccctttcttcctcgacggcgtcgtcaccgaggtcggcctgaagctc
gacgacgggatgcatccgaacggcgggggtgtcggcgtcatggtagaccgcttcctgccg
acggcggagcttttcgtccgctcacttgcgaaaggagaatga

DBGET integrated database retrieval system